KEGG   Cellvibrio japonicus: CJA_0246Help
Entry
CJA_0246          CDS       T00721                                 

Gene name
aga27A
Definition
putative alpha-galactosidase, aga27A (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cja  Cellvibrio japonicus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CJA_0246 (aga27A)
  Lipid metabolism
   00561 Glycerolipid metabolism
    CJA_0246 (aga27A)
   00600 Sphingolipid metabolism
    CJA_0246 (aga27A)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CJA_0246 (aga27A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315172..316386
Genome map
AA seq 404 aa AA seqDB search
MRKQLLLGLGLVSALLVSVQASAQKFEQLAKTPQMGWNSWNTFGCNVDEKMIRAMADAMV
TSGMKAAGYEYINIDDCWHGERDKNGFIQADKKHFPSGMKALADYVHAKGLKLGIYSDAG
NTTCAGRPGSRGHEYQDALTYASWGIDYVKYDWCDTQDINPKSAYATMRDAIHKAGRPML
FSICEWGDNQPWEWAQDVGHSWRTTGDIYPCWNCEHNHGSWSSFGVLPILDKQAGLRKYA
GPGHWNDMDMMEVGNGMTEEEDRAHFSLWAFMASPLIAGNDLRNMSDTTRAILTHKETIA
INQDKLGIQAMKWIDEGDLEIYIKPLEKGHYAVLFLNRADDAMDYRFDWSFHYMKDDISK
HEIFFDKQAFNWRNIWNGETGSTKEVLNIKVPAHGVVVLRLSPR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaacaactcctcctcggtctgggcctggtcagtgccctgttggtgtcagtacag
gccagcgcacaaaaatttgagcaactcgctaaaacaccgcaaatgggttggaatagctgg
aataccttcggctgcaacgtggatgaaaaaatgattcgcgcaatggccgatgccatggtc
acatccggtatgaaggctgccggttatgaatacattaatattgacgattgctggcacggc
gagcgcgataaaaatggctttatccaggcggataaaaaacatttcccttcgggcatgaaa
gcacttgctgattacgtgcatgccaaaggtttgaaattggggatttattccgatgccggt
aataccacctgtgccggccgccccggcagtcgcggccatgaataccaggacgcactgacc
tacgcgagttggggtatcgattacgtaaaatacgattggtgcgatacccaggatattaat
cccaagtccgcctacgccaccatgcgcgatgccatccataaagcgggccgccccatgttg
ttcagtatttgcgaatggggcgataaccagccctgggaatgggcgcaggatgtcggccat
tcctggcgcacaaccggcgacatctatccctgttggaactgcgaacacaaccacggctcc
tggtcttcctttggggtgttgcccatcctcgacaaacaagcgggcttgcgtaaatacgcc
ggccccggccactggaatgacatggatatgatggaagtgggcaacggcatgaccgaggaa
gaagatcgcgcgcatttctcactctgggcatttatggcatcaccgctgattgccggcaat
gacctgcgcaacatgagcgacaccacccgcgctatcctgacccacaaggaaaccattgcg
attaaccaggacaaactgggcatccaggccatgaagtggatcgatgaaggcgacctggag
atttatatcaagccattggaaaaaggccattacgctgtgctgttcctcaatcgtgccgat
gatgccatggactatcgttttgactggtctttccattacatgaaagacgatatcagcaag
cacgaaattttctttgataagcaggcctttaactggcgcaatatctggaatggtgaaaca
ggctctacaaaagaggtgctgaatatcaaggtgccagcgcacggtgtcgtggtattgcgt
ttaagcccgcgttaa

DBGET integrated database retrieval system