KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_01690Help
Entry
A911_01690        CDS       T02264                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00260  Glycine, serine and threonine metabolism
cjp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjp01100  Metabolic pathways
cjp01110  Biosynthesis of secondary metabolites
cjp01130  Biosynthesis of antibiotics
cjp01230  Biosynthesis of amino acids
Module
cjp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A911_01690 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A911_01690 (trpA)
Enzymes [BR:cjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A911_01690 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB PucR IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFU42463
Structure
PDB: 

Jmol
Position
319799..320548
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIYNVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattagatcaaagccctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggtgtagatatttacaatgtttttgagcttttagct
aggatcaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttaattaaagagtgtgaaagatataatatagct
ttaatcacacttgtaagcgttacaacccctaaagaaagggttaaaaagttggtaaaacat
gctaaaggttttatttatttattagcaagtataggtattacaggtacaaaaagtgtcgaa
gaagcaatcttacaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggttttggcattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgatgga
gtgattgtgggaactagcatagtaaagtgttttaaacaaggaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system