KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_01690Help
Entry
A911_01690        CDS       T02264                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A911_01690 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A911_01690 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A911_01690 (trpA)
Enzymes [BR:cjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A911_01690 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319787..320536
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIYNVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattagatcaaagccctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggtgtagatatttacaatgtttttgagcttttagct
aggatcaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttaattaaagagtgtgaaagatataatatagct
ttaatcacacttgtaagcgttacaacccctaaagaaagggttaaaaagttggtaaaacat
gctaaaggttttatttatttattagcaagtataggtattacaggtacaaaaagtgtcgaa
gaagcaatcttacaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggttttggcattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgatgga
gtgattgtgggaactagcatagtaaagtgttttaaacaaggaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system