KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0763Help
Entry
C8J_0763          CDS       T00597                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cju01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cju00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cju00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769268..770680
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVKNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILTLFDLKNSDEKVFEARNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggtcgagagtagaaatgtaaaaaatgtatcaagttttaaggaagctttgatt
aacccaaacgccccagaaggagggctttactcacctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
ggacctacaagagcttttaaagatatggctttgcagccttttggcgtgcttttaagtgaa
ttttcaaaggataaaaatattttaattatttgtgctacaagcggcgatacaggacctgca
accctaaaaagctttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataacttgaaagtt
tttgccatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaatgaaattaaagctttaaattatgagctttgcgcagctaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcatcgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaac
gcaaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttaaaaaatgag
agatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagtaaaattttaattgatccg
cataccgcaacttgttttaaaatgcttgatcctttaaaacctagcattatcacttctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatatgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttgactttatttgatttgaaaaatagcgatgaaaaggtatttgaagccagaaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system