KEGG   Clostridium kluyveri NBRC 12016: CKR_0626Help
Entry
CKR_0626          CDS       T00832                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKR_0626
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKR_0626
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CKR_0626
Enzymes [BR:ckr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CKR_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689806..691296
Genome map
AA seq 496 aa AA seqDB search
MKEIYYNSTRGLNKNFTASRAILNGISEDGGLFIPHTIPFIDEEELKKLKYMTYKELALC
IIEKFFTDFSKEELKECIDLAYDNKFESDKIVPLEKVGDVFYLELFHGPTLAFKDMALCL
LPHLMKTAAKKQKLHKEIVILTATSGDTGKAALEGFANVEGTKIVVFFPEQGVSKIQKKQ
MVTQQGGNTKVVGIEGNFDDAQSEVKKIFNDHELKEELNENSYRFSSANSINIGRLIPQV
VYYFYGYMELLRRGEINFGNKINFSVPTGNFGNILAAYYAKKMGLPINKLICASNENRVL
YDFFENGTYDAEREFILTISPSMDILISSNLERLIYDISGKDSTVVNKLMTNLSEHSKYT
VSESMKEELKVFYGGFASEEETLKCIKETFDTYQYLMDTHTSVAYSVYKNYLRDTCDDTK
TIVVSTASPFKFTKSVMSALDTKYSYQEDLELVEVMSKIASLEIPAPIRKLEDSKVVHNT
VCKREEMKEEIRKFLL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagatttattataatagtaccagaggtctaaataaaaattttactgcatccagg
gcaatattaaatggaatatccgaggatgggggattatttattccgcacaccatacctttt
atagatgaagaggaattaaaaaaacttaagtatatgacttataaggaattggccttgtgt
ataattgaaaaattctttacagactttagcaaagaagaattaaaagaatgtatagattta
gcctatgataataaatttgaatcagataaaatagttcctttggaaaaagtgggagatgta
ttctatcttgaactatttcatggtcccactttagcttttaaggacatggcattatgcctt
ctaccacatttgatgaagactgctgctaaaaaacagaagttacataaagaaatagtaata
cttacagctacatccggagatacaggaaaggctgctttggagggttttgcaaatgtagaa
gggactaaaatagtagtattcttcccggaacagggagtaagcaagattcaaaaaaaacag
atggtgacccaacaggggggaaatacaaaagtagtaggtatagaaggaaactttgatgat
gcccaaagcgaagtaaagaaaattttcaatgatcatgaattaaaggaagaactaaatgaa
aattcctacagattttcttctgccaattccataaacataggaagactcattcctcaggta
gtttattatttttatggatatatggaacttttgagaagaggagaaataaactttgggaac
aaaataaatttttctgttcctacaggaaactttgggaatatacttgcggcttattatgct
aaaaagatgggacttccaattaacaagctcatatgcgcatcaaatgaaaatagggtactt
tacgatttctttgaaaatggaacctatgatgcagaaagagaatttattttaactatatct
ccttccatggatatacttatatcaagcaatcttgagagacttatatatgatataagcggc
aaggattccacggttgtgaacaaactgatgacaaatttaagtgaacacagtaagtataca
gttagtgaaagcatgaaagaggaattgaaggtattttacggaggatttgcaagcgaagaa
gaaactttgaagtgcataaaagaaacttttgatacatatcagtatcttatggatactcat
acctctgtagcctattctgtctataaaaattacttgagggatacttgtgatgatacaaaa
accatagtggtttcaacagcaagtccatttaagttcaccaaatctgtaatgagtgctttg
gacactaaatatagctaccaggaagatctggaacttgtagaagttatgagtaaaattgca
tcacttgaaattccagcacctataagaaaattggaagatagtaaagttgttcataatact
gtgtgtaaaagggaagagatgaaggaagaaattagaaaatttttattgtag

DBGET integrated database retrieval system