KEGG   Clostridium sp. BNL1100: Clo1100_1202Help
Entry
Clo1100_1202      CDS       T01708                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clb00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clb00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1388598..1389662
Genome map
AA seq 354 aa AA seqDB search
MSITKKNFAKMPDGTQVDIYTLKNSNNMSIDILNYGGTIVSILMPDKNGKIADIALGFDD
IKRYMENDAYMGALIGRHGNRIEGAEFELNGKVYELVKNDGNNHLHGGTIGFHNVVWNAE
IQEEKGVQKLVLTHTSPDGEENYPGNLNVKVEYSLSENNELKIDYNAVSDKDTVVNLTNH
AYFNLSGHDSGDVLKHQIYINADKFTPVNDECIPTGEIRDVKGTVMDFTKLSSFSEGISS
GDEQIVYGLGYDHNWVLNTEGNINEVACELYEPESGRAMQVFTTKPGIQFYSGNHLNEKV
ELIGKNNTVYNKRTGLCLETQFFPNAMKHKNFPSPILKANETYHYVTIYKFFNK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaataactaagaagaattttgcaaaaatgcctgatggtactcaagtagatatttat
accttgaaaaattcaaacaatatgtctatagacatattaaactacggaggaactattgtt
tctatacttatgccggataaaaacgggaagattgcggatattgctttgggattcgatgat
attaaaagatatatggaaaatgatgcatatatgggagcattaattggaagacatggcaat
cgtattgagggtgcggaattcgaattaaacggaaaagtttacgaacttgtgaagaatgat
ggtaataaccatcttcacggcggtacaataggttttcataatgtagtatggaatgctgaa
atacaagaagaaaaaggagttcaaaagttagttttaactcacactagccctgacggtgaa
gaaaattaccccggaaatctcaacgtaaaggtagaatattcactttccgaaaataatgag
ttaaagatagactataatgcggtttctgataaggacacggttgtaaatcttacaaaccat
gcatatttcaacctatccggacatgattccggagatgttttaaaacatcagatatatatt
aatgcagacaaatttactcctgtaaatgacgaatgtattcctaccggagaaatacgcgat
gttaaaggtactgtaatggactttactaaattgagtagtttttcagaagggatttccagc
ggcgacgagcagattgtatatggtctgggttacgaccataactgggtactgaatacagaa
ggaaatataaatgaagttgcttgtgagctatatgaacctgaaagcggccgtgctatgcag
gtattcacaacaaaaccgggtattcagttttattccggaaaccatttaaatgaaaaagta
gagttgattggaaagaataatactgtttacaacaagagaacgggcctttgtcttgaaaca
cagtttttccctaatgcaatgaagcataagaattttccatcaccgattcttaaagctaat
gaaacgtatcattatgtaactatatataaattttttaataaataa

DBGET integrated database retrieval system