KEGG   Caldicellulosiruptor lactoaceticus: Calla_1722Help
Entry
Calla_1722        CDS       T01600                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calla_1722
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_1722
   00020 Citrate cycle (TCA cycle)
    Calla_1722
   00620 Pyruvate metabolism
    Calla_1722
   00640 Propanoate metabolism
    Calla_1722
   00650 Butanoate metabolism
    Calla_1722
  Energy metabolism
   00680 Methane metabolism
    Calla_1722
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calla_1722
Enzymes [BR:clc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calla_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1805921..1806496)
Genome map
AA seq 191 aa AA seqDB search
MGKMIEIRWHGRGGQGAKTASLLLAEAAFNTGKYVQGFPEYGPERMGAPITAYNRISDEK
ITIHSNIYEPDYVVVVDETLIGSVDVTKGLKKDGAIIVNTSKSPEEVRKMLGNFDGKVYT
IDARKISMECLGKYFPNIPVLGAVIKVTGIIPEEEAIKDMEGSLKHKFATKPDVIEGNLK
AFVRGMQEVQG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatgattgaaataagatggcatggtcgaggtggccagggtgcaaagacagct
tctcttcttttagctgaagctgctttcaacacaggcaagtacgttcaaggttttcctgag
tatggtccagagcgaatgggtgctcctatcacagcttacaacagaataagcgatgagaag
atcaccattcacagcaacatttatgaacctgactatgtagttgttgttgatgaaacgtta
atcggaagtgttgatgtaacaaaagggctcaaaaaagatggtgcgataattgtcaatact
tcaaagtctcctgaagaagtaaggaagatgcttgggaactttgatggaaaggtttacaca
attgatgcaagaaagatttcaatggagtgtttgggcaagtacttcccgaatatccctgtt
cttggtgcagttataaaggtaacaggtattattcccgaagaagaagcaataaaggatatg
gaagggtcgctcaagcacaagtttgcaacaaagccagatgtgattgagggtaacctcaaa
gcgtttgttagaggaatgcaggaggtgcaaggatga

DBGET integrated database retrieval system