KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00158Help
Entry
CPK_ORF00158      CDS       T01859                                 

Definition
putative exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPK_ORF00158
Enzymes [BR:clp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CPK_ORF00158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232303..1233784)
Genome map
AA seq 493 aa AA seqDB search
MHTEFAPFLEDLVHQQVISLLDIAFASKHISSDFEESFVFLAVSSALWRYGHPFLSLEEN
RIRPSLGGISETDLYRGFHNLPKEVRDKLFVVVSGRLYLRSLYTIRSKLLDKLSLLCSAT
PNYFPPSIDSSILSEEQNFIFNKITQGCFSIVSGGPGTGKTFLAAQLILSLVKQQPKLRI
AIVSPTGKATSHIRQILMKYNIFDDMVLMQTVHHFLQEYAYRRYNSIDVLLVDEGSMVTF
DLLYSLVQTLQGYEKDKKLYTSSLIILGDTNQLPPIGIGVGNPLQDLIGYFHENTFFLKT
SHRAKTGAVDQLTQSVLRGEMIPFSPLPSISSAIEVLKDRFVKSLRQSEARLCVLTPMRH
GPWGVLNLNTMIHQRLARSDPDLRIPIMVTSRYETWGLFNGDTGLLCLKTQKLHFPQHEP
IDSRALSQYVYNYVMSVHKSQGSEYDEVIVIIPKGSEVFGVSILYTAITRAKYRVSVWGD
PETLHKIIKKSNY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgcacacagaatttgctccttttttagaagacttagtacatcagcaggtgatatccctt
ttagacatcgcttttgcttctaagcacatctcttcggactttgaagagtcttttgttttt
ctcgcggtctcctcagcgctttggcgttatggtcatccttttctttcccttgaggaaaat
cgcattagaccttctctaggagggatctcagaaacagatttgtatcggggatttcataac
cttcctaaggaagttcgagataaattatttgtcgttgtttcaggacgtttgtatttacgg
tctctgtatacgatacgatcgaaactcttagacaagctttcgttgctttgttcagcaacc
ccgaattattttcctccttctatagattcttcgatcctttcagaagagcaaaactttatt
tttaataaaataactcaaggatgtttttctatagtttctggaggcccaggaacaggaaaa
acttttttagctgcacaactcatcctctctttagtgaagcagcaacctaagttacgtatt
gctatagtatctcctacaggaaaggccacgtctcatattcgtcagattcttatgaaatat
aatatatttgacgacatggtgttgatgcagacggtgcaccactttcttcaggagtatgcg
taccgtcgctataactctatagatgtccttttagtagatgaaggctccatggtaactttt
gacttgttgtatagtttggtacaaaccctacagggatatgagaaagacaaaaaactttat
acctcgagtttaattattctcggagataccaatcaattgcctcctattggcattggggtt
ggaaatccccttcaagatctcataggatatttccatgaaaatacgtttttcctgaagaca
tcgcatagggcaaagactggagctgtggatcagctgactcaatctgtattgcgtggcgaa
atgattcctttttctcctctcccatcgatatcctcagctatagaagtcttgaaagatcgt
tttgtaaagtcgttacgtcaatcagaagcacgtttgtgtgtattgactcctatgcgccat
ggcccttggggggttctgaacttaaacacaatgatacatcaaagattggcgagaagcgat
cctgatttacgtattcctattatggtgacgagtcgttatgaaacttggggactatttaat
ggagacacaggattactgtgtttaaaaactcagaaattgcatttccctcaacatgaaccc
atagattctagggctctctcacaatacgtctacaattacgttatgtctgtacacaagagc
caggggagtgaatacgatgaggttattgtaattattcccaagggaagcgaagtgtttggg
gtgtctattctctatactgcaattacccgagctaaatatagagtttcagtttggggagat
cccgagacgttacataagataattaagaagtctaattactag

DBGET integrated database retrieval system