KEGG   Clavispora lusitaniae: CLUG_00089Help
Entry
CLUG_00089        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
clu  Clavispora lusitaniae
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:clu04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 738 aa AA seqDB search
MNVSSGTRTPFLSSRSLPEDDNTFAPPALSAYGIALLSDKTDLASRSSLSGVYGEDIKEN
TALKNSLKSRLSVHFKDNGAAKDSGNASSTNSHSSSIYNSGSHNSSSHNISLSTSNHTLS
GTSFNSSSNFNGDDNDEFEDQSGDTIGKLDLMTATTPGGSDASSTRPSSTGLTNTKRSRL
ARRFKSLGPPKRASEMPPSSGDQDGNSGSSSGKQSPVTPSNDKDPAFTQSSQIQTPIRSS
IMSPAENGVDRKRTITGDSKFFKSLEIMKQKSPGLEPLADVKAKSPVAAERGPTKRSRSQ
NSSVFPGVSNSSSVSAFDPLLSQDKPRIPLQTISSNIMNIETGLSTFRKPKAPKLSFPHN
TSINADSASKYSHTPAVSSVEPLMSTRLSTEDQKTKKVIVINSRRYEKLELIGRGGTSKV
YKVRCMETNNQLAIKKVAFDSFDESCVNGFKGEIELLTKLKNESRVVELIDHVVSDGSIY
LVMECGEIDLAHVFSNRLAAGSSIDLGFVRFHAIEVLRCVEAVHRAGIVHSDLKPANFLF
VKGILKIIDFGIANAVPDHTANIYRESQIGTPNYMAPEALVETNHLNLAPGSEKKSTKWR
VGRPSDIWSCGCIIYQMIYGRPPYGSYSGQQRIMAIMNPQVKIQYPTKGIGEIPVPLSAI
ELMQKCLARNPNDRWTVEECLNSNFLKPRAVSENFVKDLVYSAVNFGFNARHTGEITDEV
YDRLVETVLKQIEDLNYA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtctcatctggtacgcgaacgccgtttcttctgctgaggctgctaccggaggat
gacaatacgtttgcgcctccggctttgagtgcctacggaatagcacttttaagtgacaag
acagacctagcttccagatcctccttgtctggcgtttacggagaggatatcaaggagaac
actgcattgaagaactccttaaagtctcgattatctgttcatttcaaggacaacggggct
gcaaaagattctggaaacgctagcagcaccaacagccatagctctagtatttataatagt
ggtagccataactcgagcagccataacatcagcctcagcacaagcaatcatactcttagc
ggtacttccttcaactcatcttccaatttcaatggtgatgacaacgacgaattcgaagac
caatcaggtgataccattgggaaactcgacttgatgacagcaacaacccctggcgggtct
gatgccagttcaacgcgaccctcctcgaccggccttaccaatacaaagcgttctcgacta
gcacgaaggttcaagtcccttgggcctccaaaaagggcttctgaaatgcctccaagtctg
ggtgatcaggatggcaattccggctcctcttctggtaagcaatctccagtgacaccatca
aatgataaagatccagcattcacgcaatcttctcaaatccaaacacccatacgactgtca
attatgtccccagcagaaaatggggttgatagaaagagaactattacgggtgactcgaaa
ttcttcaagagtctagagataatgaaacaaaagtctccaggattggagccgcttgcagat
gttaaggcaaaatcaccagtcgctgctgaaaggggacccacaaaacgttcccgatcgcaa
aactcttcagtctttcctggagtgctgaattcatcctcagtttcagcgttcgatcctttg
ctatcgcaagacaagccacgcattcccttacaaaccatctcgtctaatatcatgaacata
gagacgggcctttctactttcaggaaaccaaaagctcctaagctttcatttcctcataat
acatctattaatgccgactcggcttcaaaatattcgcatactccggcagtgagctcggtg
gagccactcatgtccacaaggctcctgacagaagaccagaaaaccaagaaagtcatcgtt
atcaattctaggcggtacgaaaaacttgaactcataggtagaggtggaacttctaaggtc
tacaaggttcgatgtatggaaacgaataatcagttggctataaagaaagtggcatttgac
ctgtttgacgaatcatgcgtgaatggctttaagggcgagattgagttgttgacgaaattg
aaaaacgagtcgcgggtggtcgagttgatcgatcacgttgttagcgatggctcaatctac
cttgtcatggaatgcggtgagattgacttagcacacgtatttctgaacagattagccgct
gggtcatctatcgatttgggttttgttcgtttccatgccatcgaggtgctaaggtgtgtt
gaggctgtgcaccgtgctggtattgtgcacagtgacttgaagccagccaattttctattt
gtgaaggggattttaaaaatcattgactttggcatagctaacgcggtgccagatcacacg
gcaaacatttatcgtgagtctcaaattggaacgccaaattacatggcaccagaagcattg
gtggagaccaaccatttgaatttggctccaggatcagagaaaaagagtaccaaatggcgg
gtcgggcggccttctgacatatggtcttgcggttgcatcatttatcaaatgatttacggc
cggccgccatatggatcgtattcaggacaacaaaggattatggctatcatgaacccacaa
gtgaagatccagtatcccacgaagggtattggagaaattcctgttcctttgagcgcaata
gagctcatgcaaaagtgcctagccagaaatcctaatgatcggtggactgtggaggaatgt
ttgaactctaattttttgaaaccccgggcagtgagtgaaaactttgtgaaggacttggtt
tattctgcagttaatttcggtttcaatgcgagacacactggtgagattacggatgaggtt
tacgataggcttgtggagactgtgctcaaacagattgaagatttgaactatgcatag

DBGET integrated database retrieval system