KEGG   Clavispora lusitaniae: CLUG_04374Help
Entry
CLUG_04374        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CLUG_04374
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_04374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 728 aa AA seqDB search
MTVEKPGQLPYGDGSFKIFGMENYGNTCYCNSILQCLFYTSKFRTELLKYNYTPHERRRT
ISGASPHGFTTKYEQLKSKRIKQQSKSSDGVQSNGSSAAAGKSSMRSSIFGKFSNLGNSN
GNEDISSSKHSAYIENAATCHGLAIDQKLIVQRNPDLHCLQILVTRPNAMDEAENRNDNS
NSSAALLDSNNSSQRQLSGEEAVGSVTAQSAFVIVGIPQPEPNVNPPINPFSPHPSAEQR
KRSALINGPILNLDYPLSDEGKKNETCLLYALKDLFEAMVENESQIGVVSPAYFVRKLKD
KNYLFRQVNMHQDAHEFCNYLINETIESVVHEKGEANNWCTNIFQGIITNETKCLSCESI
TSKDETFLDLSIDIPPGESAYSLTYSLNNFSKSETLNHQNKFYCNTCSSLQEAVKTIKLK
KTPEILVINFKRFKYDDKLDRMVKLFDSISYPLKLRLFNTTSAGKQTDNAKPEDFSLYGL
YALVVHIGGGPMHGHYVALCKCKAGLWFLFDDETVELVDESYVLRFFGNGPGLASAYILF
YEKLDTSLDDGSGLDFGIDLNGIYNGDDYTMALQQMSPSCENGKHVEKKRDNAPSDYEEF
TYPEPYAPVSDATSVGRKSSIFKKSFMFESKENGDTVTKSVSRTSSNKDYAPDAPAQNGN
GKTMNIFEKKTWVNGLKRKESKAEIPQQDRKVSQGSIKTLGSMKSEASGEVKEKRRGSIF
GFKRKSKS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggagaaaccgggccagcttccgtacggagacgggtctttcaagattttcggc
atggaaaactacggcaacacatgctactgcaactccatactacagtgtcttttttacaca
tccaagtttcggactgagcttttgaagtacaattataccccacacgagcgcaggcgtaca
atcagtggtgcctctccacacggtttcactaccaaatacgaacaattgaaaagcaagcgg
ataaagcagcagtctaaactgtctgatggcgtgcaactgaatggcagttctgcggctgca
ggcaagagttctatgcgcagctcaatcttcggcaagttttccaacttggggaatctgaac
ggaaacgaagacatcctgctgtcgaagcatctggcgtatattgaaaacgcagccacgtgt
cacggcttggcaatagaccagaaactcatagtgcagagaaacccagacttgcactgtctc
cagatattggtgacgcggccaaatgctatggacgaggctgaaaacagaaacgacaactcc
aactcttctgcggcccttttagactccaacaacagcagccagaggcaactcagcggagaa
gaggctgtcggttctgtcacagctcagtctgcctttgtcatcgtcggcattcctcaacca
gaacctaatgtgaatccgcccatcaatccattttctccccatccgtctgccgagcaacgg
aaacgctcggcgttgattaacgggcccatcttgaacttggattatccgctttctgacgaa
ggtaagaagaacgaaacatgtcttttatatgcgttaaaggatttgtttgaggcgatggtg
gaaaatgaatcgcagattggcgtggtttctccagcatacttcgttcgcaagctaaaggac
aagaactatttgttccgccaagtcaacatgcaccaggatgctcacgaattttgcaattac
ttgatcaacgaaaccatagaaagtgtcgttcacgaaaaaggcgaggcaaacaactggtgc
accaacatatttcaaggaataatcaccaatgaaacaaaatgcttatcgtgcgagtcaata
acgtccaaagacgaaacctttttggacctctcaattgatattcctcctggagaaagtgcc
tactcgctaacatattcgcttaacaatttttcaaagctggagacgttgaaccaccaaaac
aaattctactgcaacacatgcctgtcgttacaagaggcggtgaaaacaatcaaattaaag
aagacgccagaaatcttagtgatcaactttaagcggttcaagtatgatgataaacttgac
cgaatggtgaaactttttgactctatactgtacccgttgaaacttcgacttttcaacact
acgagcgcgggcaaacaaacagacaacgcaaagccagaggattttagcttgtatggtttg
tatgctctcgtggtacatattgggggcgggcctatgcatggacattatgtggctttgtgc
aaatgtaaagctgggctctggtttttgtttgatgacgaaactgttgaattagtggacgaa
tcctatgtgcttcgtttttttggaaacggaccgggccttgccagtgcttacattttattc
tacgaaaaacttgatacatcattagatgatggaagcggtctagattttggtatcgacttg
aatggcatttacaatggtgatgactataccatggctctacagcaaatgagtccgtcgtgt
gagaatgggaagcatgtggaaaagaagcgggacaatgctcctagtgactatgaagaattc
acatatcctgagccatacgctccagtttctgatgcaactagtgtgggacggaaactgtcg
atattcaaaaaatcattcatgttcgaatcgaaagaaaatggagacacagtgacaaaatct
gtatcacgtacttcttccaacaaagattatgctcctgatgcgcctgctcaaaacgggaat
gggaaaaccatgaacatttttgagaagaagacatgggtgaatggcctcaagaggaaagag
ctgaaggcagaaattccacaacaagatcgcaaagtctcccagggaagtataaagacgttg
gggagcatgaaatccgaagccagtggcgaggttaaagaaaaaagaagaggaagtattttc
ggattcaaaagaaagagcaagagctga

DBGET integrated database retrieval system