KEGG   Clavispora lusitaniae: CLUG_04866Help
Entry
CLUG_04866        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
clu  Clavispora lusitaniae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:clu03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 885 aa AA seqDB search
MYKNAQFKPPRLIRKTPPEESLFVRDSERPARRLGSTRRLETRSKDTENKETQEHRERIE
SGNAQIDNSGDTDTNEVKKTPISEPGLADPPTQLPSSTVKRRVLNNANGSSPDPLHTRIH
IHNPLSHQQDSELPGSAKRAKMSPRYYTVQWRKRSNRKHKPWEGDGVMVVSDSGSVLKIE
NKGTYRIVGRSKSTDTDGILRFGTYEAEVDCETSKEELVQQKDEKPALVSSPLRDSAPMK
KHIPRIAGPISAPSPTPKVDAVVESAAPSLVLPAPKIPNANDVSVDPLLTKHLKPHQRDG
VSFVYSCLLGIHQPNYFGALLADEMGLGKTLMTITVIWTLLKQSPFPGQKKVASKVLICC
PVSLIDNWRREFTKWLGTYRIGVLCLNNKQVSPAKDKDDIVNFGKNNVYQVLIMSYEKTL
SCSKELDALNLDILVCDEGHRLKSGSNRVFKVLSALSVEKRLLLTGTPIQNDLNEFYTII
NFINPGILGTQSEFQKNYLRPILRARDVNCHDLKIIREGKDKSAELIQLTKSFILRRTKD
IISNCLTRKTDVIIFCAPTKVQKSLFEAVSKSSKFNSVMRSETKDVLSMILMFRKICNSP
SLLHNDPLFASFLHDTELSSSPLSSRTTGSKVNVLVPLLLEFRTVGEKVVLVSNYAQTLD
FLETVLSKLNLQYCRLDGSTPAKVRDKLVLDFNKCPTHKIFLLSAKAGGVGLNLVGASRL
ILFDNDWNPSVDLQAMARVHRYGQTKPVFIYRLFTTGAIDEKIFQRQLMKNNLSDMFLDE
KSSSASNIFDFEDLKDLFTIADTNCNTHDLIECDCEGTGEDIDLTQAEPKDTQEDEELPS
SGWMSALEFKELDGTTAAKRQVMRTALSNYRHFDPSVCAESIDTG
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaatgcccagttcaagccgccccgtcttatccggaaaacgccgccggaggaa
agtctctttgtccgggattcagagcgcccggcccgccgtttggggagtacgcgtcgccta
gaaaccagatccaaagacaccgaaaacaaagagacgcaagagcacagagaaagaatagag
agcgggaatgcccaaatagacaatagcggcgatacagataccaatgaagtgaaaaagact
cccatctcagaaccaggacttgccgatcctccaactcaactaccttccagtaccgtcaag
agacgcgtattgaacaacgccaatggatccagtcctgatccactacatacaaggatccac
atccacaatccgcttctgcatcaacaagactccgaattgccaggctccgctaaaagagcc
aaaatgtctccccggtattacacggtgcaatggcggaaacgctcgaatcgcaaacataag
ccatgggaaggtgacggcgttatggttgtttctgacagtgggtcggttttgaagatagag
aataaaggcacgtaccgcatcgtgggccgctccaaaagtaccgacacagacggcattttg
cgtttcggcacttacgaggctgaggtggactgtgaaacctcaaaggaagagctcgtccag
caaaaggacgaaaaaccggctctagtgtcgctgcctcttcgagattctgctcctatgaag
aaacatattccacgcatagcaggcccaatatctgctccatctcctacacctaaagtagat
gcggttgttgaatcagcagcgccatccctagttcttccagctccgaaaatccccaatgct
aatgacgtttctgttgatccactcttgactaaacatctaaaaccgcaccagagagacggc
gtgtcatttgtctactcttgccttttgggcatccaccagccgaattactttggagcgctc
ttggctgatgaaatgggtctcgggaaaacattgatgaccatcactgtcatctggactttg
ctcaaacagagtcctttccccggccagaaaaaagtggcttccaaagttctcatttgctgc
cccgtgtctcttatcgacaattggcgccgtgaattcaccaaatggcttggaacttatcgc
atcggtgttctttgtttgaacaacaagcaagtgtctccagcaaaggataaagacgatata
gtgaattttggcaaaaataacgtataccaagtgctaataatgagctacgagaaaactttg
tcttgttcaaaggaactagatgcgctcaacttggatattttggtttgtgatgagggccac
cgcttgaaaagcggctccaatagagtattcaaagttttactggctttgctggtggaaaag
agattgcttctcacaggtacacctatccaaaatgacctcaatgaattttacaccattatc
aactttattaaccccgggattttgggcactcaatctgaatttcagaagaattatttgcgg
cctatcttgcgggctcgtgacgtgaattgtcatgatttaaaaatcatcagagaaggcaaa
gataagtctgcagagttgattcaattgactaaatcttttattctccggcgcactaaagat
attatcagcaactgcttaactagaaaaacggatgtaataattttttgtgctccaacaaaa
gtccagaaactgcttttcgaagcggtttccaagtcatcaaagtttaactccgtgatgaga
tcagaaaccaaagatgtgctttcaatgattctcatgttccgcaaaatctgcaactctccc
tcccttttgcacaatgatcctctttttgcctcgtttcttcacgacactgaattatcgtcg
tctccactttcatctagaactacaggtagcaaagtcaatgtacttgtacctcttctactc
gagttccgaacagtgggagaaaaagtggttttggtgtcaaactatgcccaaaccttagat
ttcctagagactgtgcttctgaaactcaatcttcaatattgccgtctcgatggaagcaca
ccagccaaggtgcgagataaattggtgcttgacttcaacaagtgcccgacccacaaaatc
tttcttctttcggctaaagctggaggtgttgggcttaacttagttggagcttcgcggttg
attcttttcgataacgactggaacccgctggtggatcttcaagcgatggccagagttcat
cggtacggtcaaacaaagccagttttcatctacagacttttcaccactggtgctatcgac
gaaaaaatcttccaaaggcagctaatgaaaaacaatttgagtgacatgtttttggatgag
aaactgtcttcggccctgaatattttcgactttgaagacctaaaggatttgtttactatt
gcagacacaaactgcaacacacatgatttgattgaatgtgattgcgaaggaacaggtgag
gatattgatttaactcaagctgaaccaaaggacactcaagaagatgaggagctcccgtct
tcaggctggatgagcgctttagaattcaaagaattagatggcaccactgccgctaaaagg
caagtgatgcggacggcactttccaattatagacattttgatccttctgtgtgtgctgaa
tcaatcgatacagggtga

DBGET integrated database retrieval system