KEGG   Clavispora lusitaniae: CLUG_04866Help
Entry
CLUG_04866        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
clu  Clavispora lusitaniae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLUG_04866
Enzymes [BR:clu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CLUG_04866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 885 aa AA seqDB search
MYKNAQFKPPRLIRKTPPEESLFVRDSERPARRLGSTRRLETRSKDTENKETQEHRERIE
SGNAQIDNSGDTDTNEVKKTPISEPGLADPPTQLPSSTVKRRVLNNANGSSPDPLHTRIH
IHNPLSHQQDSELPGSAKRAKMSPRYYTVQWRKRSNRKHKPWEGDGVMVVSDSGSVLKIE
NKGTYRIVGRSKSTDTDGILRFGTYEAEVDCETSKEELVQQKDEKPALVSSPLRDSAPMK
KHIPRIAGPISAPSPTPKVDAVVESAAPSLVLPAPKIPNANDVSVDPLLTKHLKPHQRDG
VSFVYSCLLGIHQPNYFGALLADEMGLGKTLMTITVIWTLLKQSPFPGQKKVASKVLICC
PVSLIDNWRREFTKWLGTYRIGVLCLNNKQVSPAKDKDDIVNFGKNNVYQVLIMSYEKTL
SCSKELDALNLDILVCDEGHRLKSGSNRVFKVLSALSVEKRLLLTGTPIQNDLNEFYTII
NFINPGILGTQSEFQKNYLRPILRARDVNCHDLKIIREGKDKSAELIQLTKSFILRRTKD
IISNCLTRKTDVIIFCAPTKVQKSLFEAVSKSSKFNSVMRSETKDVLSMILMFRKICNSP
SLLHNDPLFASFLHDTELSSSPLSSRTTGSKVNVLVPLLLEFRTVGEKVVLVSNYAQTLD
FLETVLSKLNLQYCRLDGSTPAKVRDKLVLDFNKCPTHKIFLLSAKAGGVGLNLVGASRL
ILFDNDWNPSVDLQAMARVHRYGQTKPVFIYRLFTTGAIDEKIFQRQLMKNNLSDMFLDE
KSSSASNIFDFEDLKDLFTIADTNCNTHDLIECDCEGTGEDIDLTQAEPKDTQEDEELPS
SGWMSALEFKELDGTTAAKRQVMRTALSNYRHFDPSVCAESIDTG
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaatgcccagttcaagccgccccgtcttatccggaaaacgccgccggaggaa
agtctctttgtccgggattcagagcgcccggcccgccgtttggggagtacgcgtcgccta
gaaaccagatccaaagacaccgaaaacaaagagacgcaagagcacagagaaagaatagag
agcgggaatgcccaaatagacaatagcggcgatacagataccaatgaagtgaaaaagact
cccatctcagaaccaggacttgccgatcctccaactcaactaccttccagtaccgtcaag
agacgcgtattgaacaacgccaatggatccagtcctgatccactacatacaaggatccac
atccacaatccgcttctgcatcaacaagactccgaattgccaggctccgctaaaagagcc
aaaatgtctccccggtattacacggtgcaatggcggaaacgctcgaatcgcaaacataag
ccatgggaaggtgacggcgttatggttgtttctgacagtgggtcggttttgaagatagag
aataaaggcacgtaccgcatcgtgggccgctccaaaagtaccgacacagacggcattttg
cgtttcggcacttacgaggctgaggtggactgtgaaacctcaaaggaagagctcgtccag
caaaaggacgaaaaaccggctctagtgtcgctgcctcttcgagattctgctcctatgaag
aaacatattccacgcatagcaggcccaatatctgctccatctcctacacctaaagtagat
gcggttgttgaatcagcagcgccatccctagttcttccagctccgaaaatccccaatgct
aatgacgtttctgttgatccactcttgactaaacatctaaaaccgcaccagagagacggc
gtgtcatttgtctactcttgccttttgggcatccaccagccgaattactttggagcgctc
ttggctgatgaaatgggtctcgggaaaacattgatgaccatcactgtcatctggactttg
ctcaaacagagtcctttccccggccagaaaaaagtggcttccaaagttctcatttgctgc
cccgtgtctcttatcgacaattggcgccgtgaattcaccaaatggcttggaacttatcgc
atcggtgttctttgtttgaacaacaagcaagtgtctccagcaaaggataaagacgatata
gtgaattttggcaaaaataacgtataccaagtgctaataatgagctacgagaaaactttg
tcttgttcaaaggaactagatgcgctcaacttggatattttggtttgtgatgagggccac
cgcttgaaaagcggctccaatagagtattcaaagttttactggctttgctggtggaaaag
agattgcttctcacaggtacacctatccaaaatgacctcaatgaattttacaccattatc
aactttattaaccccgggattttgggcactcaatctgaatttcagaagaattatttgcgg
cctatcttgcgggctcgtgacgtgaattgtcatgatttaaaaatcatcagagaaggcaaa
gataagtctgcagagttgattcaattgactaaatcttttattctccggcgcactaaagat
attatcagcaactgcttaactagaaaaacggatgtaataattttttgtgctccaacaaaa
gtccagaaactgcttttcgaagcggtttccaagtcatcaaagtttaactccgtgatgaga
tcagaaaccaaagatgtgctttcaatgattctcatgttccgcaaaatctgcaactctccc
tcccttttgcacaatgatcctctttttgcctcgtttcttcacgacactgaattatcgtcg
tctccactttcatctagaactacaggtagcaaagtcaatgtacttgtacctcttctactc
gagttccgaacagtgggagaaaaagtggttttggtgtcaaactatgcccaaaccttagat
ttcctagagactgtgcttctgaaactcaatcttcaatattgccgtctcgatggaagcaca
ccagccaaggtgcgagataaattggtgcttgacttcaacaagtgcccgacccacaaaatc
tttcttctttcggctaaagctggaggtgttgggcttaacttagttggagcttcgcggttg
attcttttcgataacgactggaacccgctggtggatcttcaagcgatggccagagttcat
cggtacggtcaaacaaagccagttttcatctacagacttttcaccactggtgctatcgac
gaaaaaatcttccaaaggcagctaatgaaaaacaatttgagtgacatgtttttggatgag
aaactgtcttcggccctgaatattttcgactttgaagacctaaaggatttgtttactatt
gcagacacaaactgcaacacacatgatttgattgaatgtgattgcgaaggaacaggtgag
gatattgatttaactcaagctgaaccaaaggacactcaagaagatgaggagctcccgtct
tcaggctggatgagcgctttagaattcaaagaattagatggcaccactgccgctaaaagg
caagtgatgcggacggcactttccaattatagacattttgatccttctgtgtgtgctgaa
tcaatcgatacagggtga

DBGET integrated database retrieval system