KEGG   Chelonia mydas (green sea turtle): 102941095Help
Entry
102941095         CDS       T02989                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102941095
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102941095
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102941095
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102941095
  Exosomal proteins of breast milk
   102941095
Heparan sulfate/heparin binding proteins [BR:cmy00536]
 Enzymes (General comment) Variety
  102941095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 488 aa AA seqDB search
MARGARLAALGLWIHYLAALCTATATTQATVPRSTRETKRDFEGIESKFSLRTADEPDDD
ICYLVPGQEDTVARCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVVVVD
WLSRAQQHYPVSAAYTKLVGKDVAVFIDWMEEQFNYPLDNLHLLGYSLGAHAAGIAGSLT
KNKINRITGLDPAGPNFEYAEATTRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDI
YPNGGGFQPGCNLGEALRLIAEKGLGDVDQLVKCSHERSIHLFIDSLLYEDKPSLAYRCN
TRETFEKGLCLSCRKNRCNNLGYKVNKVRAKRNSKMYLKTRSQMPYKVFHYQVKVHFFGK
VNVTKTNQPFLVSLYGTSDESKNIALVLPEISTNKTYSFLVYTEVNIGDLLMLTLQWEKE
SIFSWSDWWTSYAFDIQRVRVKAGETQKKMVFCSQDGISHLRRGKKAVMFVKCADKPNKR
DKGDQSRP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggggagcacggctggcagccctgggcctgtggatccactacctcgctgctctc
tgcacagctactgccacgacacaagccactgtcccaagaagcaccagagaaacaaagaga
gactttgaggggatcgagagcaaattttctttaaggacagctgacgaacctgacgatgac
atctgctacttggtccctggtcaagaagacaccgtggcacgatgcaacttcaaccatacc
agtaaaacctttgtggtgatccatggatggacggtaactggaatgtatgagagctgggtc
ccaaagctggtggatgctctgtataagagagaacctgactctaatgtcgtcgtagtagat
tggctaagccgtgcccagcagcattatccagtatctgctgcctacactaaactggtggga
aaggatgtagcagtatttattgactggatggaggagcaattcaattacccactcgacaac
ctccatttgctgggctatagtcttggtgcgcatgctgctgggattgctggaagtctgacc
aaaaataagattaacaggatcactggtttagatccagctggacctaactttgaatatgct
gaagcaaccacacgcctctccccagatgatgctgattttgtcgatgtcctacacacctac
accagggggtctccagatcgcagcattgggatacagaagcccgttgggcatattgacatc
tacccaaatggaggaggcttccagccaggctgtaatctaggtgaagctctacgcctgatt
gcagaaaaaggccttggagatgtggatcaactggtgaagtgctctcacgaacgctccatc
cacctcttcatcgactccctcttgtacgaagacaagccaagcctggcctatcgctgcaac
acaagggaaacctttgagaaggggctgtgtctgagctgcaggaagaaccgttgcaacaat
ctgggctataaggtcaacaaagtgagagccaagagaaacagcaaaatgtatttgaagact
cgctctcagatgccctataaagtctttcattaccaggtcaaggtccatttttttggcaag
gtgaatgtgaccaagacaaatcagccgttcctggtctctttgtatggcacgtccgatgag
agcaagaacattgctttggtactacctgaaatttccacaaacaagacctactccttcttg
gtttacaccgaagtcaatattggagacctcctcatgctgacattgcagtgggagaaggaa
tccattttcagctggtcggactggtggacctcctatgcttttgacatccagagggttaga
gtgaaggcaggagaaactcagaaaaagatggtgttctgctctcaagatgggatctctcac
ctcagaagagggaagaaggctgtgatgtttgtgaaatgtgctgataagcccaacaaaaga
gacaaaggagaccagtcaagaccttaa

DBGET integrated database retrieval system