KEGG   Cryptococcus neoformans B-3501A: CNBI3510Help
Entry
CNBI3510          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNBI3510
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CNBI3510
Enzymes [BR:cnb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CNBI3510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 549 aa AA seqDB search
MSSEKAEFDAEVKAFEAFAKSPRFARTTRPYTAADVVSKRGTLPISYPSDVQAKKLWKIL
ESKARGEGGGCTATYGALDPVQLTQMAKYLETVYVSGWQCSSTASSSLEPGPDLADYPSN
TVPNKVAQLFTAQLYHDRKQRYTRSAALANGQDPGERIDYLRPIVADADTGHGGLTAVMR
LTKMMVESGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAMRLQCDIMGTTNLVV
CRTDSEAATLLSTNIDPRDHSFILGSTNPSLPPLNDLMIAAEMEGKYGQELQKIEDAWTK
QAGLKLWPDVLADALSKHGVSSKKITEFREQSIGTSHASTLQLAQSFGLPPSATPYWSWD
TPRSREGYYRYQGGTQCAINRAIAFAPYADLLWMETKSPIYAQAKEFAEGVHKVHPGQWL
AYNLSPSFNWEKAGLGKKEMKEYVWELGKLGFVFQFITLAGLHSNAYINDLFANAFSKEG
MKAYVELIQSREREIGCDVLTHQKWSGADYADAMLMTVTGGVSSTAAMGKGVTENQFVDD
KTKDALHKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgagaaagcagagtttgacgccgaagtcaaagcctttgaggccttcgccaag
tccccacggttcgcacgaacaacccgcccatacaccgctgccgacgtcgtctccaaacgt
ggtactctccccatttcttacccttctgacgtccaggcgaaaaagctgtggaagatcttg
gagtcaaaagctcgtggtgagggcgggggatgtactgctacttatggcgctctcgatcca
gtgcagttgacccaaatggcgaaatatctcgagactgtatacgtatctggctggcaatgt
tcttccactgcttcatcttccctcgaacccggacccgaccttgcagactatccatccaac
accgtccccaacaaagtcgcccaactcttcacagcccaactctaccacgatcgcaaacaa
cgatacacccgctccgccgctttggccaatggccaagacccaggagagaggattgattat
ctcagacctatcgtggctgatgctgatactgggcatggtggtttgacggcagtgatgaga
ctgacaaagatgatggtcgagagtggagcagcgggaatccatatcgaggatcaagcgcct
ggtacgaagaaatgtggtcatatggctggcaaggtcctcgtccccatctccgaacatatc
aaccgcctcgtcgccatgcgtctccaatgcgacatcatgggcaccaccaacctcgtcgtc
tgccgtaccgactctgaagccgccacactcctctccactaacattgaccctcgggaccac
tcctttatcttgggttctaccaacccttccttaccccctcttaacgatctcatgatcgct
gccgagatggagggaaagtacggacaagaactccagaaaatcgaggatgcatggacgaaa
caggcgggattgaaactatggcccgacgtactcgccgacgctctctcgaagcacggcgtc
tcttccaaaaaaatcaccgagtttagagaacagtcgatcggcacctctcacgcttccact
ctccagctcgcccagtcgttcggtctccccccctcggccaccccttactggtcatgggac
accccgcgttcccgcgagggttactaccgctaccaaggcggcacccaatgcgctatcaac
cgcgccatcgcctttgcaccttatgccgacctcctctggatggagaccaagtctcccatc
tacgcgcaagcgaaagagtttgcggaaggcgtacataaagtccatccaggtcaatggttg
gcgtacaacctgagcccgagtttcaattgggaaaaggcagggttggggaagaaggagatg
aaagagtatgtgtgggagctgggaaaacttggtttcgtcttccaattcatcactctcgcc
ggcctccactcgaacgcctatatcaacgacctcttcgccaacgccttctcaaaggaaggt
atgaaggcctatgtcgagttgattcaaagtcgagaacgggagattggatgtgatgtcttg
actcatcaaaagtggtcaggcgcagactatgcagacgcaatgttgatgacggtcaccggc
ggtgtctcatccaccgctgctatgggcaaaggcgtgacggaaaaccagtttgtagatgat
aagaccaaggacgctttgcataagctctaa

DBGET integrated database retrieval system