KEGG   Cupriavidus necator: CNE_1c21700Help
Entry
CNE_1c21700       CDS       T01564                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cnc  Cupriavidus necator
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cnc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cnc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cnc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2243820..2245265)
Genome map
AA seq 481 aa AA seqDB search
MKYQSTRGHELPQTFSEILLGGLAPDGGLYLPTEYPQVTADELESWRKLSYADLAYEILR
KFSDDIPAEDLRALTRKTYTAEVYCNAREGDNTADITPLRTLGEEGGTKLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALGRAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDANIFNLAVEGVFDDCQDIVKAVSNDLDYKARQKIGTVNSINWARVV
AQVVYYFKGWLLATSGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGQDAGKLAALFRDVEEKGGF
DLSGTPEFDRIRQFGFVSGRSTHQDRLATIRDLSSRYGITIDTHTADGVKVAREHLSAGV
PMVVLETALPAKFADTIREALGHEPERPARFEGIERLPQRFEVMPADAAQVKAYIAGHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccatgagctgccgcaaaccttctccgagatcctgctg
ggcggcctggcgccggacggcgggctgtacctgcccaccgagtacccgcaagtcacggcc
gatgagctcgaatcctggcgcaagctgtcgtatgccgacctggcctacgagatcctgcgc
aagttcagcgacgatattcccgccgaggacctgcgcgcgctgacgcgcaagacctatacc
gccgaggtgtactgcaacgcacgcgagggcgacaacaccgccgacatcacacccctgcgc
acgctgggcgaggaaggcggcaccaagctgcaactgctgggcctgtccaacggcccgacg
ctggccttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacgcgctgggc
cgcgccgggcaggagctgaacatcctgggcgcgacctcgggcgataccggcagcgccgcc
gagtacgcgatgcgcggcaagcgcggtatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggatgccaacatcttcaacttg
gcggtcgaaggcgtgttcgacgactgccaggacatcgtcaaggcggtctccaacgacctc
gactacaaggcgcgccagaagatcggcacggtcaactcgatcaactgggcgcgcgtggtg
gcccaggtggtgtactacttcaagggctggctgctggctaccagcggcccgggccagaag
gtctcgttctgcgtgccgtccggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggcctgccgatcgacaagctggtggtcgccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggcgcctaccgcgtgcgcaagtcggccgagacgtaccacacgtcg
agcccgagcatggatatctccaaggcctcgaacttcgagcgcttcgtgttcgacctgctg
ggccaggacgccggcaagctggcggcgctgttccgtgacgtggaagagaagggcggcttc
gacctgtcgggcacgccggaattcgaccgtatccgccagtttggctttgtctcgggccgc
agcacgcaccaggaccggctggccaccatccgcgacctgtcgtcgcgctacggcatcacc
atcgatacccacaccgccgatggcgtcaaggtggcgcgcgagcatctcagcgccggtgtg
ccgatggtggtgctggaaaccgcgctgcccgccaagttcgccgacaccatccgcgaagcg
ctcggccacgagccggagcgcccggccaggttcgagggcatcgagaggctgccgcagcgc
tttgaagtgatgcccgccgacgccgcgcaggtcaaggcctacatcgccggccacaccggc
ctgtaa

DBGET integrated database retrieval system