KEGG   Cupriavidus necator N-1: CNE_1c21700Help
Entry
CNE_1c21700       CDS       T01564                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00260  Glycine, serine and threonine metabolism
cnc00750  Vitamin B6 metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01230  Biosynthesis of amino acids
Module
cnc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNE_1c21700 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CNE_1c21700 (thrC)
Enzymes [BR:cnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CNE_1c21700 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEI77505
UniProt: G0EZS0
Position
1:complement(2243820..2245265)
Genome map
AA seq 481 aa AA seqDB search
MKYQSTRGHELPQTFSEILLGGLAPDGGLYLPTEYPQVTADELESWRKLSYADLAYEILR
KFSDDIPAEDLRALTRKTYTAEVYCNAREGDNTADITPLRTLGEEGGTKLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALGRAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDANIFNLAVEGVFDDCQDIVKAVSNDLDYKARQKIGTVNSINWARVV
AQVVYYFKGWLLATSGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGQDAGKLAALFRDVEEKGGF
DLSGTPEFDRIRQFGFVSGRSTHQDRLATIRDLSSRYGITIDTHTADGVKVAREHLSAGV
PMVVLETALPAKFADTIREALGHEPERPARFEGIERLPQRFEVMPADAAQVKAYIAGHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccatgagctgccgcaaaccttctccgagatcctgctg
ggcggcctggcgccggacggcgggctgtacctgcccaccgagtacccgcaagtcacggcc
gatgagctcgaatcctggcgcaagctgtcgtatgccgacctggcctacgagatcctgcgc
aagttcagcgacgatattcccgccgaggacctgcgcgcgctgacgcgcaagacctatacc
gccgaggtgtactgcaacgcacgcgagggcgacaacaccgccgacatcacacccctgcgc
acgctgggcgaggaaggcggcaccaagctgcaactgctgggcctgtccaacggcccgacg
ctggccttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacgcgctgggc
cgcgccgggcaggagctgaacatcctgggcgcgacctcgggcgataccggcagcgccgcc
gagtacgcgatgcgcggcaagcgcggtatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggatgccaacatcttcaacttg
gcggtcgaaggcgtgttcgacgactgccaggacatcgtcaaggcggtctccaacgacctc
gactacaaggcgcgccagaagatcggcacggtcaactcgatcaactgggcgcgcgtggtg
gcccaggtggtgtactacttcaagggctggctgctggctaccagcggcccgggccagaag
gtctcgttctgcgtgccgtccggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggcctgccgatcgacaagctggtggtcgccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggcgcctaccgcgtgcgcaagtcggccgagacgtaccacacgtcg
agcccgagcatggatatctccaaggcctcgaacttcgagcgcttcgtgttcgacctgctg
ggccaggacgccggcaagctggcggcgctgttccgtgacgtggaagagaagggcggcttc
gacctgtcgggcacgccggaattcgaccgtatccgccagtttggctttgtctcgggccgc
agcacgcaccaggaccggctggccaccatccgcgacctgtcgtcgcgctacggcatcacc
atcgatacccacaccgccgatggcgtcaaggtggcgcgcgagcatctcagcgccggtgtg
ccgatggtggtgctggaaaccgcgctgcccgccaagttcgccgacaccatccgcgaagcg
ctcggccacgagccggagcgcccggccaggttcgagggcatcgagaggctgccgcagcgc
tttgaagtgatgcccgccgacgccgcgcaggtcaaggcctacatcgccggccacaccggc
ctgtaa

DBGET integrated database retrieval system