KEGG   Cupriavidus necator N-1: CNE_1c27750Help
Entry
CNE_1c27750       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV AAA_22 T2SSE FtsK_SpoIIIE ATPase_2 AAA_16 AIG1 TrwB_AAD_bind DUF87 AAA_10 DUF4913 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEI78089
UniProt: G0ETP0
Position
1:complement(2878469..2881354)
Genome map
AA seq 961 aa AA seqDB search
MIRSFFRTRRAERATGASEPADEAWTRHVSLLAAHGITEPGSALAAGRRNPATEAQAQAL
YDVAPSFADLLPWVEYLPESMSMLLEDGDSVAAFFELAPVGTEGRELAWLWQARDALENA
LQDSFDELEEHPWVVQLYAQDEANWDGYLRTLADYVRPRAQGIAFSEFYLRFFAHHLRAI
AKPGGLFEDTMVTRLPWRGQVRRVRMVVYRRAPATAVSRRGQSPEQSLCTICDRLVGGLA
NAGVKARRMHAADIHDWLLRWFNPHPTLLGPSAEDCERFYALTRYPEEGETGEIELASGD
FAQRLFFGQPCSDVANGVWLFDGMPHRVIVMDRLRMPPATGHITGETRKGSDAVNALFDQ
MPEDTVMCLTLVATPQDVLEAHLNHLSKKSVGETLASEQTRQDVQQARSMIGSAHKLYRG
ALVFYLRGRDLQQLDARGLQLVNVMLNAGLQLVREEDEVAPLNSYLRWLPCVFDPALDKR
QWYTQLMFAQHAANLAPVWGRSQGTGHPGITFFNRGGGPITFDPLNRLDRQMNAHLFLFG
PTGSGKSATLNNILNQITAIYRPRLFIVEAGNSFGLFGDFASRLGLSVHRVKLAPGAGVS
LAPFADAWRLVDKPGEVQTLDADDLDEDRAETTRVADAEEQRDVLGELEITARLMITGGE
DKEETRMTRADRSLIRQCILDAAQRCVADKRMVLTRDVRDALRGRAHDSTLPEIRRARLA
EMADAMDMFCQGVDGEMFDRPGTPWPEADITVVDLATFAREGYNAQLSIAYISLINTVNN
IAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWYWLATQNLDDLPKAA
EPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMASARKETGKYSEGVILSKSMEVL
FRAVPPSLYLALAQTEPEEKAERFQLMQQYGIGELDAALKIAQRIDCARGIASLPLDGLT
P
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctcattctttaggacgcgccgggccgaaagggcaaccggtgccagtgaaccg
gctgacgaggcctggacccggcatgtgtcgttactggccgcgcatggcattaccgagccc
ggcagcgcgttggccgccggccgccgcaacccggccaccgaggcgcaggcccaggcgctc
tatgatgtggccccgtccttcgccgatctgctgccctgggtcgaatatcttcccgaatcg
atgagcatgctgctggaggacggcgattcggtcgcggccttcttcgagttggcccctgtc
ggcactgaagggcgcgaactggcctggctgtggcaggcgcgcgacgcgctggagaacgcg
ctgcaggattccttcgatgaactggaagagcatccctgggtggtccagctctatgctcag
gacgaggcgaattgggacggctatctgcgcacgctggcagactacgtccggccacgtgct
cagggcatcgccttcagcgagttctatctgcgcttcttcgcgcaccatctgcgcgcgatc
gccaagccaggcgggctgtttgaggacaccatggtcacacgcttgccgtggcgcggccag
gtccggcgcgtgcgcatggtagtctaccggcgcgcacccgcgacagcggtttcccgacgc
ggccagtcgcccgagcagtctctctgcacgatctgtgatcgactcgtgggcgggctcgcc
aatgcgggcgtgaaggcccgccgcatgcatgcggccgacatccatgactggctgctgcgc
tggttcaacccgcatccgacgctgctggggccgagtgctgaagattgcgagcgcttctac
gcgctgacccgctaccccgaggagggggaaacaggcgagatcgaactggctagcggcgac
tttgcccagcgcttgttcttcgggcagccgtgctcggacgtggccaacggcgtctggctc
ttcgacgggatgccgcatcgggtcattgtgatggaccgcctgcgcatgcctccggcgacg
ggacacataaccggtgagactcgcaagggaagcgatgcagtcaatgcgctattcgaccag
atgccggaagatacggtgatgtgtcttaccctggtcgctacgcctcaggacgtgctagag
gcgcacctgaaccacctgagcaagaaatcggtgggcgagacactagcttcggagcagact
cgccaggacgtgcagcaggcgcgcagcatgattggcagcgcgcacaagctctaccgcggc
gcgctggtcttctacctgcgggggcgcgacctgcagcagctcgacgcccgcggcctgcaa
ctggtcaacgtcatgctcaacgctggtctacagttggtgcgcgaggaagacgaggtggcg
ccgctcaacagctacctgcgctggttgccctgcgtcttcgacccggccctggacaagcgg
cagtggtacacccagctcatgttcgcgcagcacgccgcgaacttggcgccggtgtggggc
cgcagccagggcacggggcatccgggcatcacctttttcaaccgtggcggcgggccgatc
accttcgatccgcttaaccggctggacaggcagatgaacgcgcatctgtttcttttcggt
cccaccggctcgggcaagagcgccacgctcaacaacattctgaatcagatcacggcgatc
taccggccgcgcctgtttatcgtcgaggcgggcaatagcttcggtcttttcggcgacttt
gcctcgcgcctgggcctgtcggtccaccgtgtcaagctcgctcccggcgctggcgtgagc
ttggcccctttcgccgacgcctggcgcctggtagataagcctggtgaagtgcaaacgctg
gatgccgatgacctggatgaggaccgcgccgagacaacgcgggtcgcagacgctgaggag
cagcgcgatgtgctcggtgagctggagatcacggcgcggctgatgatcaccggcggcgaa
gacaaggaagagacgcggatgacgcgagcagaccgcagcctcattcgtcagtgcatcctc
gacgcggctcagcgttgtgtggccgataagcgaatggtactcacgcgcgatgtgcgcgac
gcactgcgcgggcgcgctcacgattcgacactgccggagatccgtcgcgcccgactggcg
gaaatggccgacgcaatggacatgttctgccagggcgtggatggcgaaatgttcgatcgg
cccggtacgccttggcccgaagccgacatcaccgtcgtagatctggcgaccttcgcgcgc
gagggctacaacgcccagctctccatcgcttacatcagcctcatcaacacggtgaacaac
atcgccgagcgcgaccagtttctcgggcggccgattatcaacgtgaccgatgaggggcac
attatcaccaagaacccgctgcttgcgccctacgtcgtcaagatcaccaagatgtggcgc
aagctcggcgcctggtactggcttgcgactcagaaccttgatgatttgcccaaggcggcc
gaaccaatgctcaacatgattgagtggtggatttgcctgtcgatgccgccggatgaggta
gagaaaatcgcacgcttccgcgagctgagcccggcacagaaggcgctgatggcgtcggca
cgcaaggagacgggcaagtatagtgagggcgtgatcctctccaaatcgatggaagtgttg
tttcgtgctgtcccacccagcctctacttggccctggctcagacggaaccggaggagaaa
gccgagcgcttccagttgatgcagcagtacggcattggcgaactggatgctgcattgaag
atcgctcagaggatcgactgcgcccgcggcatcgcatcgcttccgctcgatggattgacg
ccgtaa

DBGET integrated database retrieval system