KEGG   Caldicellulosiruptor owensensis: Calow_0563Help
Entry
Calow_0563        CDS       T01347                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00010  Glycolysis / Gluconeogenesis
cow00020  Citrate cycle (TCA cycle)
cow00620  Pyruvate metabolism
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01120  Microbial metabolism in diverse environments
cow01130  Biosynthesis of antibiotics
cow01200  Carbon metabolism
Module
cow_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_0563
   00020 Citrate cycle (TCA cycle)
    Calow_0563
   00620 Pyruvate metabolism
    Calow_0563
Enzymes [BR:cow01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Calow_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 CAT
Motif
Other DBs
NCBI-ProteinID: ADQ04143
UniProt: E4Q4Q1
Position
648358..649719
Genome map
AA seq 453 aa AA seqDB search
MATPVIMPKQGQTVESCIITKWHKKKGDKVEVGDLLFSYETDKASFDEEAKVNGILLDIF
FEEGEEVPVLTNVCVIGEPGEDVQQFNPKASSEVQKVHISHLQTSEQDVPGETQTEISKH
YSPIEGKIKISPRAKNLAEKLNIDFRFAKPSGPDGRIIERDILKLFESGPVFTSAAKHEA
KEIEDAQILEPTGIGGRITTFDIERAKHESYVSKTSESSDQNVEYEDVPLSNIRKAIAKA
MYLSLTTTAQLTLHTSFDASKVLEFRKKVKENREKLGLEDITINDIILFAVSRVLPKHKL
LNSHFLDDKIRYFKNVHLGFAVDTERGLMVPTIFNCNQKTLSQISKEAKELIGLCRKGTI
SPDLLKGATFTITNLGSFGIEIFTPVLNPPQTGILGVNTIVQRSKEEDGQIKFYPAMGLS
LTFDHRALDGADAARFLKDLKELLENFDLLLAL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgtaataatgcccaagcagggacagactgttgaaagctgtataattaca
aagtggcacaagaaaaaaggtgataaggttgaggttggcgaccttttattttcttatgag
accgacaaggcgagctttgatgaggaagcaaaggtaaacggtatacttcttgacatcttc
tttgaagagggtgaagaagttcctgttttaactaatgtgtgtgtgattggtgaacctggt
gaggatgtgcagcagttcaatccaaaggcttcctcagaagtccaaaaagttcacatttca
catttgcagacatctgagcaagatgtcccgggggaaactcaaacagagatttcaaagcac
tattctccaattgaagggaaaataaaaatttcacccagagcaaagaacttagctgaaaaa
ttaaatattgactttaggtttgcaaaaccttcagggccagatggaagaataattgaaaga
gacattttaaaactttttgagtcagggccagtgtttacaagtgcggcaaagcacgaagca
aaagaaattgaagatgctcaaattttagagccaactggcattggtggtagaattacaact
tttgacattgaaagggcaaagcatgaaagctatgtctcaaaaacttctgagtcttccgac
cagaatgtagaatatgaagatgtgccgctttcaaatatcagaaaggctattgcaaaggct
atgtatctatcacttaccacaacagctcagctgacgttacacacatcatttgatgcaagt
aaagtccttgagtttaggaaaaaagtgaaagaaaacagagaaaaactggggcttgaggat
atcacaataaacgatataatcctttttgctgtctcaagggttttaccaaaacacaaattg
ctcaatagtcattttttggatgataaaattagatatttcaagaatgttcatcttggattt
gcagttgacacagagcgtggtcttatggtaccaacaatattcaactgtaaccaaaagact
ttgagccaaatctcaaaagaagcaaaggagctaattggcctttgcagaaaaggaacaatc
tcaccagaccttttaaaaggagcaacattcactattactaatttaggaagctttggcata
gaaatttttacacctgtcctgaatcctcctcagacagggattttgggtgtaaatacaatt
gttcagaggtctaaggaagaagatggacagataaaattctatcctgcaatggggttatca
ctaacgtttgatcacagagcgttagatggagccgatgcagcaaggtttttgaaggattta
aaggagcttttagaaaactttgatttgcttttggcactctga

DBGET integrated database retrieval system