KEGG   Caldicellulosiruptor owensensis: Calow_1431Help
Entry
Calow_1431        CDS       T01347                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00260  Glycine, serine and threonine metabolism
cow00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01130  Biosynthesis of antibiotics
cow01230  Biosynthesis of amino acids
Module
cow_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calow_1431
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calow_1431
Enzymes [BR:cow01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calow_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ04978
UniProt: E4Q2W0
Position
complement(1511919..1513100)
Genome map
AA seq 393 aa AA seqDB search
MDRYFGRFGGIYAPETLMPALLEIEEEFCKLVKDENFILEYEYYLKNYVGRPSPLYFAKN
LSEHLGVKIYLKREDLNHTGAHKINNCIGQALLAKHIGKKRLIAETGAGQHGVATATVAA
LFGMECEIFMGEEDAKRQFHNVQRMKMLGSKVRVVNKGSKTLKDAINEAMRDWSETFEYT
FYLFGTAAGPHPFPTIVKYFQSVIGKETKEQIKRLEGRLPDYIFACVGGGSNAIGIFSAF
LEDHEVKLIGVEGAGEGIHTGKTAATLCSGSVGILHGAKTYILQDEEGQIQNTHSISAGL
DYPGVGPEHAYLKETGRVEYVGATDKEAVDAFLLLTRLEGIIPALESSHALAEVIKRAKM
GLFKTSDIVVVNLSGRGDKDINTVLELWKDDEL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataggtattttggaaggtttggtggaatatatgcaccagaaactcttatgccagct
cttttagagatagaagaagagttttgcaagcttgtgaaagatgaaaattttattctggaa
tatgagtactatcttaaaaactatgttggaagaccatcgccactttactttgccaaaaac
ttgagcgagcatcttggagttaaaatatatctcaaaagagaagacctaaaccacaccggt
gcacataaaataaacaactgcattggccaggcacttttggcaaagcatataggcaaaaaa
agacttattgccgagacaggagcaggtcagcacggtgttgcaacggctacagttgctgct
cttttcgggatggaatgcgagatatttatgggtgaagaagatgcaaaaaggcagtttcat
aacgtgcagaggatgaaaatgcttggcagcaaggtaagagtagttaacaagggaagcaag
accttgaaagacgcaataaacgaggcaatgcgtgactggagcgagacgtttgagtatacc
ttttatctttttggcacggctgcaggacctcatccgttcccaacaattgtaaaatacttt
caaagtgtgattgggaaagagacaaaagagcagataaaaaggcttgaaggaagacttcca
gactatatctttgcgtgtgtaggtggtggttctaatgcaattggtatcttttcagcgttt
ttggaagatcatgaggtaaaacttattggtgttgagggtgcaggagagggaatacataca
ggcaaaacggcggcgacgctatgtagtgggtctgttggaatcttgcatggtgcaaagaca
tatattttacaggatgaagaagggcaaattcaaaacacacattcaatctcagcagggctt
gactacccgggtgttggacctgaacatgcatatttgaaagagacaggaagggttgagtat
gtaggggctactgacaaagaagctgtggatgcatttttgctgctcacaaggcttgaaggg
ataattccagctttagagagcagccatgcccttgcagaggttattaaaagggcaaagatg
ggactgttcaaaaccagtgacattgtggttgtgaacctttctggaagaggtgataaggat
ataaatacagtacttgagctttggaaggatgatgagctatga

DBGET integrated database retrieval system