KEGG   Clostridium perfringens 13: CPE0954Help
Entry
CPE0954           CDS       T00074                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cpe  Clostridium perfringens 13
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CPE0954 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CPE0954 (gpo)
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CPE0954 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1152358..1152894
Genome map
AA seq 178 aa AA seqDB search
MLYDFKVKDIEGNEVSLGEYKGKVLLIVNTATGCGFTPQYEGLEVLYKKYHDKGFEILDF
PCNQFFEQAPGSNEEIVGFCKLNYGTTFKTFAKVEVNGENACELYKFLKKEAPMAKEDET
SLGFYDKLKGLGFTTEGEEIKWNFTKFLIDKNGEVVARFAPTFEPEKLDELIEELLEE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgctatatgattttaaagttaaggatattgaaggaaatgaggtttctttaggggagtat
aaaggaaaggttcttttaatagttaatactgcaacaggatgtggatttactcctcaatat
gaaggattagaagtgctttataaaaaataccatgataaagggtttgaaatattagatttt
ccatgtaatcagttctttgagcaagcaccaggaagcaatgaagaaatcgttggattttgc
aaattaaactatggaactacatttaagacctttgcaaaagtagaggttaatggagagaat
gcttgtgaattatacaaatttttaaagaaagaagctccaatggcaaaggaagatgaaaca
tctttaggattttatgataaattaaaaggcttaggatttactacagaaggagaagaaata
aagtggaatttcactaagtttttaatagataaaaatggtgaagttgttgctagatttgca
cctacatttgaacctgaaaagttagatgaattaatagaagaattattagaagaataa

DBGET integrated database retrieval system