KEGG   Chitinophaga pinensis: Cpin_7206Help
Entry
Cpin_7206         CDS       T00959                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
cpi  Chitinophaga pinensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cpi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cpi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(9002753..9007252)
Genome map
AA seq 1499 aa AA seqDB search
MKKANYIVAIGASAGGLEAIHEFFDNMPEYGNLSFVIIQHLSPDYKSLLVELVSKHTNMK
VREVEEDMGIENDCVYVIPNNKEIIVEQGRLRLVQKPAEKAPNTAIDTFLFSLAKDQGRQ
AICIILSGTGTDGTKGAAAVKKAGGMVMVQDPETAKFDGMPRSVIGSENMDYVLAPEFMP
GEIYNYIQDMPVQVFNGKIDEELLAEVFQLVREHSGQDFHHYKPPTITRRIAKRMAQFNI
KTLEEYLQLLRSSEEESKALAKDFLIGVTRFFRDKTAFDILKEQVISKLVEEKEEGAILK
IWVTACSTGEEAYSLAIMLDQCLQEKNKWLDIKIFATDIDSNAIEFAARGIYPSSVVKEV
EPSILKKYFIKEDKKYQIAPRLRKQIVFARHNILKDPPFIKNDLVTCRNMLIYMENVLQR
QVLSSLHFALNTGGILFLGPSESASLIRGGLEELSQKWKIYRKTDSSRSPLPDNLYSPLE
YIRQNREVRANGNMRMSAEKKSTNLLEDFREVMAEDFGYAAVYIDKAYEIHEALGNYKKF
LSLPEKRLNLNLLKMVPGDLSMALNIALRQAWTTEKKSMVKGVKVTTPEGVRVVNIMIKP
GTANMQYTMVVFNEDVEKNNVSGDTPDTHAQPADIKEHIMSLEAELGETRTNLQMAIEGL
ETSNEELQSSNEELLSANEELQSSNEELQSLNEELHTLNTEHQLKIKELVELNDDMDNYF
RSTDIGQVFVDGSMRIRKFNQAAIKMINLIPSDVGRPINHISTNIQQDSMVEDIHAVIRS
RRIVEKEMVLSNGNMHLMKILPYIRQDKQTDGVVITFVDITMIKELDMLLKGVFNASTNV
ILAFKPVRNEVGVITDFRLVAANSEGLRFLGKDVASQKHPSMKQTMSSLLDHGLFEKYIQ
VVDHEAVLHTEFHLESKQQDYWYEMSGVKTQDGNMVITCADVTEKKDAEDRLRRNYNELV
QARESLRTLNSDLEYKVLERTRELTMSEERFRLVSKATNDTVWDWNLTNNTVWWSDNFYA
TYGYQKEGSNNRTFWQDNIHPEDRDRVKNSISRAINTKQSQWTEGYRMRRENGTYAFVLD
RGYLLVDEYATPYRMLGSLMDVTNLRQAERQAVVNREEKLFLAESIPLILWTAEPDGNVN
FVNEQFIAYTGKSLQELQEQGWGSVIHTDEIKAWKNSLERAVRFKEDFSMEVRICDHEGN
FHWFLHRTRAQKDADGKSTALVGTSTDIHEQKLAAEIMEQRIEERTLALKQANEDLESSN
AELQQYAFVASHDLKEPLRKIHMFGNMLKDRYQAGMEDKARDYLSRIIGSSARMASLIDD
LLRFSRLSQVSFFEQADLKVIINEILSDLEILIQEKNARVTVSPMPVIEAVPGQLRQVFQ
NLLSNAFKFSRKDIQPVINITATRIKEKKFDSPQETDGPFVCISITDNGIGFDEKYLDKI
FVLFQRLHTKDKYEGTGIGLAVTRKIIDKHNGLITAHSREKEGATFTIILPVKQDQRAG
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcgaactacatagtagctataggagcctctgcaggtggattggaagccatc
catgaattctttgataatatgccggaatacggcaacctgtcatttgttattattcagcac
ttgtctcccgattataaaagtctgctggtggaactggtttccaagcacactaatatgaaa
gtaagagaggtggaggaagatatgggaatcgagaatgactgtgtatatgtcattcccaat
aacaaagaaattatcgtagagcagggacgtctcagactggtacagaaaccagcagagaaa
gcccctaataccgctattgatacctttcttttttctcttgcaaaagatcagggccgtcag
gctatctgtattattctctccggtacgggtacagacggcaccaaaggtgctgctgctgtg
aaaaaagctggtggaatggtgatggtccaggacccggagactgccaagtttgacggtatg
ccccgcagtgtgatcggttctgaaaatatggattatgtgctggctcccgaatttatgccg
ggagagatctataactatatccaggatatgccggtacaggtctttaatggcaagatcgat
gaagagttactggcagaagtatttcagttggtgagagaacatagcggccaggattttcat
cattataaaccgcctactattacccgccgtatcgcgaagcgaatggcgcaattcaatata
aaaacactggaagaatacctgcaattactgcggtcaagcgaagaggaaagtaaggcgctc
gccaaagatttcctcattggcgttacccgctttttcagggataaaactgctttcgacata
ttgaaagaacaggtgatcagtaaactggtagaagagaaagaagaaggcgctattctgaaa
atatgggttactgcttgtagcaccggagaagaggcatattcgctggccataatgctggat
cagtgtctgcaggaaaagaataaatggttggatataaagatcttcgctaccgatattgat
agcaatgcgatcgagtttgccgccagagggatttatccttcttcagtagtgaaggaagta
gagccttccatcctgaagaaatacttcataaaagaagacaagaaataccagatcgcgcca
cgcctgcgtaagcagatcgtgtttgcgcgtcataatattttaaaggaccctccctttatc
aaaaatgaccttgttacctgtcgcaacatgctcatttacatggagaatgtgttgcaaaga
caggtgctttcctcattgcatttcgcgctgaataccgggggcatactcttcctggggcct
agtgaatcagcttcgctgatacgcggcggactggaagaattaagccagaagtggaagatc
tatcgcaaaacagacagttcccgttctcctttaccggataatctttatagtccgctggaa
tatatccggcaaaaccgtgaagtacgtgcaaatggaaatatgcgtatgagcgcggagaaa
aaaagcaccaatctgctggaagatttccgtgaagtgatggcagaagatttcggttatgcg
gcggtgtatattgataaggcatatgagattcatgaagcgctggggaactataagaaattt
ctttctctgccggagaagagattgaatctgaacctgctgaagatggtgcccggcgacctt
tccatggcgctcaatatcgctttgagacaggcctggaccaccgaaaagaaatcgatggtg
aaaggggtaaaagtgactacgccggaaggtgtacgggtggttaacatcatgatcaaacct
ggtaccgccaatatgcagtataccatggtggtgttcaatgaagatgtggaaaaaaacaat
gtatcgggagatacgcctgatacgcatgcacaaccggcagatataaaagaacatatcatg
tcgctggaggcagaattgggcgaaacccgtaccaatcttcagatggcgatagagggattg
gaaacctccaatgaggaattgcaatcgagtaatgaggaattactttccgccaatgaggag
ttgcaatccagcaatgaggaactgcaatcccttaatgaggagctgcataccctcaataca
gagcaccagctcaagatcaaggaactggtagaactaaatgatgatatggataactatttc
cgcagtacggacatcggacaggtgttcgtagacggtagtatgcgtatccgtaagttcaat
caggccgctataaaaatgatcaacctgatcccttctgatgtaggccgtcctatcaatcat
atctccaccaatatccagcaggatagtatggtagaggatattcatgcggtgatcaggagc
cggcgtatcgtggaaaaagagatggtgctgagtaatggcaatatgcacctgatgaagatt
ctgccctatatccggcaggataagcagacggatggtgtggtgatcacttttgtggatatt
accatgatcaaggagctggatatgctgttgaaaggcgtattcaatgccagtacgaatgtt
atcctcgcattcaaaccggtcaggaatgaggtgggcgtcattactgacttccgtctggtg
gcagcaaacagtgaagggctgcgtttcctgggtaaagatgtcgcttctcagaaacatcct
tccatgaagcagaccatgtcgtctttgctggaccacggactgtttgagaaatacatacag
gtggtagatcatgaggcggtgttgcatactgaattccacctggaaagtaaacagcaggat
tactggtatgaaatgtcgggtgtaaaaacacaggatggcaatatggtgatcacctgtgcc
gatgtaactgaaaagaaagacgcggaagaccgtttacgcagaaactacaatgaactggtg
caggccagggagagtctgcgtaccctgaactccgatctggaatataaagtgctggaaaga
acacgtgaactcaccatgagtgaagagcgtttccgcctggtatccaaagcaactaatgac
acggtatgggactggaatctgaccaacaataccgtatggtggagtgataatttttacgct
acatacggttatcagaaagaaggatccaataatcgtacgttctggcaggataatatccat
ccggaggaccgtgaccgtgtgaaaaacagtatttcccgggcgatcaataccaaacagagt
cagtggacggaaggctacagaatgcgccgggaaaacggtacatatgcttttgtactggac
cgtggctacctgttggtagatgaatatgctacaccttaccgtatgctgggttcactgatg
gatgtgactaacctacgtcaggcagagcgacaggcggtggtcaacagggaagaaaaactc
ttcctggccgaatctattccgttaatactctggacagcagaaccagatgggaatgtgaac
tttgtcaatgagcagtttatcgcttataccggcaagtccctccaggaattacaggaacag
ggatggggaagtgtgatccatactgatgaaataaaagcctggaaaaatagcctggagcgc
gctgtcagattcaaggaagatttctccatggaggtgcgtatatgtgatcatgaaggcaat
tttcactggttcctgcaccgtacccgtgcacaaaaggatgcggatggaaagtcgactgcg
ctggtaggtaccagcaccgatattcatgagcagaaactggctgcggagataatggagcag
cgtatagaggagcgtacgcttgcattaaaacaggcgaatgaggacctggaatccagtaat
gccgaattacagcaatacgcttttgtcgcctctcatgacctgaaggaaccgctccggaag
atccatatgtttggtaacatgttgaaagacaggtatcaggcaggtatggaagataaggcg
cgcgactatctgagccggattatcgggtcttcagcccgtatggccagtctgatagatgac
ctgctgcgtttctcccgtttatcgcaggtcagcttcttcgaacaggcagatctgaaagtg
attatcaatgagatactctctgatcttgagatacttatacaggaaaagaatgccagggtg
accgtatcgccaatgccggtgatagaagccgttcccggacagttacgccaggtgttccag
aatctgttgagcaatgcctttaaattctcccgcaaagatattcagccggttatcaacatt
acggctacccgcataaaagaaaaaaagtttgatagtccgcaggaaacggacggacctttt
gtatgtatctctatcacagacaacgggatagggtttgatgaaaaatacctggacaaaata
tttgtgctctttcagcgtttgcatacgaaagacaaatatgaagggaccggtatcggactg
gcggtcacccgcaagatcattgataagcataatggcctgatcactgcacatagccgtgaa
aaagaaggtgctacgtttaccattatcctgcctgtgaaacaagaccagcgtgccggttag

DBGET integrated database retrieval system