KEGG   Coprothermobacter proteolyticus: COPRO5265_1282Help
Entry
COPRO5265_1282    CDS       T00773                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152925..1153665
Genome map
AA seq 246 aa AA seqDB search
MPELRKIRGKVNLTLDIIGTQGEVHLIRSLFLKIPVETKGLFWRDPGLFRIEKLDIPYTN
SKAYKTYLRKPCSAYIFQSIPTGYGLGGSAADDALIASYTGVRPSSRDAYFLLDSSKLAL
VEGDQTNIKPLELPFPLELLVVFPPFLAETKELYRRWDANPVTTDYTEQALRALKEGDKD
TFESCFGNVFEHYLDATLRDLREHLMSFGPFIMTGSGSAFFAPLAKVRKYPDLPFRIFLI
ERWSPK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttagaaaaataagagggaaagtcaatttgaccttggatataatcggaaca
cagggagaagtgcatcttataagatccttattcttaaaaatacccgtagaaactaagggg
cttttctggagggatcctggactttttcgcatagaaaagcttgatataccttacacaaac
tcaaaagcctataaaacctatttaagaaaaccttgttctgcgtacatcttccagtccata
cccacaggttatggtctcggaggctcagcagcagatgatgcattgattgcatcatacact
ggggtaaggccctccagccgtgatgcttactttctgctagacagcagtaagctagctttg
gtagaaggagaccaaacaaatataaaacctttggaattaccttttcctttagagcttctg
gtcgtgtttccacctttccttgctgaaactaaagagttgtaccgtaggtgggatgctaat
ccagtaacaactgattatacagaacaagctttgagagctttaaaagagggtgacaaagat
actttcgaaagctgctttggcaatgtgtttgaacattatttggatgcaactttaagggat
ttgcgtgagcatttaatgtccttcgggccctttatcatgacgggttccggctctgcattc
tttgcacctttggcgaaggtaaggaagtatcctgatttaccctttagaatattcttaata
gaaaggtggtcgccaaaatga

DBGET integrated database retrieval system