KEGG   Chlamydia psittaci 01DC12: BN356_9881Help
Entry
BN356_9881        CDS       T02343                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpsd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpsd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1156276..1156764)
Genome map
AA seq 162 aa AA seqDB search
MCKILGIVACDPRGVMGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTFEGLPDKYKKNR
KIIVFSRDYHESFENVIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHI
HKCYEGDVFFPLSLIKGWRKTVLDEKENLTFCFYENFADCHS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaatactcggtatagttgcttgtgacccccggggagtcatgggaaagcaagga
aagcttccgtggaactatcctgaagatatcgaatttttttccaaaactataggaaatcat
gtcctaatcatggggagaaagacttttgagggtcttcctgataagtataagaagaaccgg
aagattattgtcttttccagggattatcatgaaagtttcgagaatgtaatctgggtatct
tctttagaggaatttagacgtttagaacaactttcttctatttttcttattggcggagga
gaattgttttctttatttttagaaaatcggatggtggatgggtgtttcataactcatatt
cacaagtgttatgagggtgatgttttcttccctctatctttaatcaaagggtggaggaaa
actgttttagatgagaaagagaacttaacattttgtttttatgaaaatttcgccgattgt
cactcgtag

DBGET integrated database retrieval system