KEGG   Chlamydia psittaci MN: B599_0515Help
Entry
B599_0515         CDS       T02311                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpsi  Chlamydia psittaci MN
Pathway
cpsi00010  Glycolysis / Gluconeogenesis
cpsi00020  Citrate cycle (TCA cycle)
cpsi00620  Pyruvate metabolism
cpsi01100  Metabolic pathways
cpsi01110  Biosynthesis of secondary metabolites
cpsi01120  Microbial metabolism in diverse environments
cpsi01130  Biosynthesis of antibiotics
cpsi01200  Carbon metabolism
Module
cpsi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B599_0515
   00020 Citrate cycle (TCA cycle)
    B599_0515
   00620 Pyruvate metabolism
    B599_0515
Enzymes [BR:cpsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B599_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFS21376
Position
complement(536698..537984)
Genome map
AA seq 428 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKNNGDKIEFGDVLLEVSTDKAVLEHTANEEGWFRDCL
VKEGTKVHIGTPIAVISSEKDEDFNLDTILPKTPEPEPPVENVQLVEEEVTKVQPSVAPM
QLAFQFKPEPPLSKPLSLKVDSSKSPISPLAKRVAKEKNLDISGIKGSGPGGRIVEKDLD
KAPTKGIAGFGYPEAPEVHPGSYHEETLSPIRDIIAQRLQAAKASIPHFYVTQKVYASPL
LALLKELQAQGIKLSINDCIVRACALALKEFPEVNSGFNSVDNKIVRFETIDISIAVAIP
DGVITPIVRCADRKNIGMISAEIKSLASKAKSQSLKEEEYKGGSFCVSNLGMTGITAFTA
IINPPQAAILAVGSVQEEPIVINGEILVGSTCILTLSIDHRVIDGYPAAMFMKRLQKILE
APSILLLN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctctattaaaaatgccgaaactttctcccaccatggaagtaggaactatcgta
aaatggcataagaacaatggcgataaaatagagtttggtgatgttctcttagaagtatca
acagataaggctgtactcgagcacacggcaaatgaagaaggctggttccgggattgtctt
gttaaagagggaacaaaagtacacataggcacacctatagctgtcatatcttcggaaaag
gatgaggatttcaacttagatactatccttcctaaaactcccgagccagaacctcctgta
gaaaatgttcaactagtggaagaagaagtcacgaaagtgcaaccatccgttgcccccatg
cagttagcctttcaatttaaacctgaacctcctctgtctaaacctctatctttaaaagta
gattcttcaaaatcccccatttctcccctagctaaacgtgtagcgaaggaaaaaaacctg
gatatttctggaatcaaaggtagcggtcctggcggacgtattgttgaaaaagacctggat
aaagctcctaccaaaggtattgcaggttttggttaccctgaagctcctgaagtgcatcct
ggatcctatcacgaggaaactctttctcctattcgagacatcattgcacagaggttacaa
gctgcgaaagcctctattccacatttttatgtaacacaaaaagtttatgcttcgccgttg
ctcgccctgcttaaggaactacaggcccaaggaattaagctgtctattaatgactgtatt
gttcgtgcttgcgccctagctttaaaagagtttcctgaagtaaattcaggcttcaatagc
gtcgacaataaaattgtacgttttgaaactatagatatttcgatagctgtggctattcct
gatggagtgattactcctattgtacgctgtgctgatcgcaagaacataggtatgatttct
gccgagattaaaagcttagcttctaaagcgaaatctcaatctttaaaagaggaagagtat
aaaggtgggtctttctgcgtttccaatttaggcatgacaggaattacagcattcacagca
attatcaatccccctcaagcagctattcttgctgtgggtagtgttcaggaagagccgata
gtaatcaatggagaaattctagttggttctacgtgtatattgacattgtctatagatcac
cgtgtaattgacggatatccagccgcaatgtttatgaagcgattgcagaaaatcttagaa
gctccttctatcctgttattaaattaa

DBGET integrated database retrieval system