KEGG   Cryptosporidium parvum: cgd3_460Help
Entry
cgd3_460          CDS       T00168                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00480  Glutathione metabolism
cpv00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    cgd3_460
  Metabolism of other amino acids
   00480 Glutathione metabolism
    cgd3_460
Enzymes [BR:cpv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     cgd3_460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 3373805
NCBI-ProteinID: XP_626631
ApiDB_CryptoDB: cgd3_460
UniProt: Q5CV33
Position
3
AA seq 218 aa AA seqDB search
MGNFLASTKITTDLASKSVYSYTLTTLEGNPFPMESLKGKVVMVTNVASKCGYTKSYYKQ
MVRIYSVFAPLGLEIIGLPSREFMGQEFEDPKEIRKFADSHNVKFPLMEICKVNGPDALE
FVQKLKRETPELYDEKSNTLSAIKWNFSRFLIDKNGKVVAFRGTRTEPNELIPKIAELLG
VSDYQNLFKNYDKLHPESGYDPKDDVCPLKQKQSEQGS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggaattttttagcatccacaaagataacaactgatctcgcgagcaagtctgtgtac
tcttatacacttacaactctcgaaggaaatccttttcctatggaaagcttgaaagggaaa
gtcgtaatggtaacaaatgttgcatccaaatgtggctacacaaaatcttattataaacaa
atggtgagaatctactctgtgtttgctcctcttggacttgagattattggtctaccctcc
agagagtttatgggtcaagaatttgaagatcctaaagagattcgcaaattcgcagattct
cataatgttaaattccctctgatggagatttgtaaagtgaatggcccagatgctttagag
tttgtacaaaagctgaaaagagagacacctgagttatatgacgaaaaaagtaacacttta
tctgcaataaaatggaacttttcaaggtttttaattgataaaaatggaaaagttgttgca
tttagaggaactaggaccgagcctaacgagcttattccaaaaatagctgaacttcttggt
gtttctgattaccagaatctttttaaaaattacgacaagctccatccggagtcaggttat
gacccaaaggatgacgtatgtcctttaaagcaaaaacaaagtgaacaaggttcttaa

DBGET integrated database retrieval system