KEGG   Coccidioides posadasii: CPC735_030150Help
Entry
CPC735_030150     CDS       T01332                                 

Definition
(RefSeq) Eukaryotic initiation factor 4E family protein
  KO
K03259  
translation initiation factor 4E
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CPC735_030150
Messenger RNA biogenesis [BR:cpw03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CPC735_030150
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CPC735_030150
Translation factors [BR:cpw03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CPC735_030150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MENANLWTRRSNSSRLSLSVSDNRDPHGRSDSPRSSSKRFGDGHGRSNPFNAISPLSTGV
SSPSTNASSAFGLGSGAFASFGSAAKTPKTPGAFDFNSSKSRTEKQDGEHSGTGSKSVKS
KGSSSSLNSTNTSGPKEHPLKSTWVVWYRPPTPKYSDYEKSTIALASISSVESFWAVYSH
LKRPSLLPTVSDYHIFKKGIRPVWEDQANKKGGKWIVRLKKGVADRYWEDLLLAMIGDQF
AEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETMKRLLNFPPDTNIVWKSHDDSI
AQRTAIDQARQDKAANSGHHQGSDRRRGANPDDSTGEKGKGSAS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcaaatctatggaccaggagatccaactccagcaggctttctttatcggta
tctgataatcgagatccacatggaaggtctgattcaccgcgtagctcgtcaaaacgattc
ggtgacgggcatggtcgctcaaatccgttcaatgcaatctccccgctttccacaggcgta
tcatcaccctccaccaatgcttcctcagcctttggccttggttccggcgctttcgcttct
ttcggatcggcagcgaagactccaaagacaccaggcgcatttgatttcaactcctccaaa
tctcgaaccgaaaaacaagatggagagcacagtggaacgggctcgaagagcgttaaatcc
aagggttcttcatcctccctcaacagtaccaataccagtggaccaaaggagcatccttta
aaatcgacgtgggttgtctggtatcgcccacccacaccaaagtactccgactacgaaaaa
tctacgattgccttagcatcgatatcttccgttgagagcttctgggccgtctattcacac
cttaaaagaccatctctccttcctacagtttcagattatcacatctttaagaaagggatt
cgccctgtatgggaggatcaagcgaataaaaaaggcgggaagtggattgttaggttgaag
aaaggagttgcagaccgttattgggaagaccttcttttagccatgattggcgatcagttc
gccgaggcgagtgacgaggtctgcggtgcagtccttagtgtccgcagcggcgaagacgtt
ttaagtgtgtggacaaggattgatggaggccgcaatatcaagattagggaaacaatgaaa
cggctattgaatttcccaccggataccaacattgtgtggaagagtcatgatgatagtata
gcccaaaggaccgctattgaccaggctcggcaagataaagctgcaaattcgggccatcat
caaggttccgaccgccgacgcggagccaatcctgatgattccacaggggaaaaggggaag
ggttcagcatcttga

DBGET integrated database retrieval system