KEGG   Coccidioides posadasii: CPC735_030150Help
Entry
CPC735_030150     CDS       T01332                                 

Definition
Eukaryotic initiation factor 4E family protein
Orthology
K03259  
translation initiation factor 4E
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CPC735_030150
Translation factors [BR:cpw03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CPC735_030150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MENANLWTRRSNSSRLSLSVSDNRDPHGRSDSPRSSSKRFGDGHGRSNPFNAISPLSTGV
SSPSTNASSAFGLGSGAFASFGSAAKTPKTPGAFDFNSSKSRTEKQDGEHSGTGSKSVKS
KGSSSSLNSTNTSGPKEHPLKSTWVVWYRPPTPKYSDYEKSTIALASISSVESFWAVYSH
LKRPSLLPTVSDYHIFKKGIRPVWEDQANKKGGKWIVRLKKGVADRYWEDLLLAMIGDQF
AEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETMKRLLNFPPDTNIVWKSHDDSI
AQRTAIDQARQDKAANSGHHQGSDRRRGANPDDSTGEKGKGSAS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcaaatctatggaccaggagatccaactccagcaggctttctttatcggta
tctgataatcgagatccacatggaaggtctgattcaccgcgtagctcgtcaaaacgattc
ggtgacgggcatggtcgctcaaatccgttcaatgcaatctccccgctttccacaggcgta
tcatcaccctccaccaatgcttcctcagcctttggccttggttccggcgctttcgcttct
ttcggatcggcagcgaagactccaaagacaccaggcgcatttgatttcaactcctccaaa
tctcgaaccgaaaaacaagatggagagcacagtggaacgggctcgaagagcgttaaatcc
aagggttcttcatcctccctcaacagtaccaataccagtggaccaaaggagcatccttta
aaatcgacgtgggttgtctggtatcgcccacccacaccaaagtactccgactacgaaaaa
tctacgattgccttagcatcgatatcttccgttgagagcttctgggccgtctattcacac
cttaaaagaccatctctccttcctacagtttcagattatcacatctttaagaaagggatt
cgccctgtatgggaggatcaagcgaataaaaaaggcgggaagtggattgttaggttgaag
aaaggagttgcagaccgttattgggaagaccttcttttagccatgattggcgatcagttc
gccgaggcgagtgacgaggtctgcggtgcagtccttagtgtccgcagcggcgaagacgtt
ttaagtgtgtggacaaggattgatggaggccgcaatatcaagattagggaaacaatgaaa
cggctattgaatttcccaccggataccaacattgtgtggaagagtcatgatgatagtata
gcccaaaggaccgctattgaccaggctcggcaagataaagctgcaaattcgggccatcat
caaggttccgaccgccgacgcggagccaatcctgatgattccacaggggaaaaggggaag
ggttcagcatcttga

DBGET integrated database retrieval system