KEGG   Lachnoclostridium phytofermentans: Cphy_3303Help
Entry
Cphy_3303         CDS       T00619                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00010  Glycolysis / Gluconeogenesis
cpy00260  Glycine, serine and threonine metabolism
cpy00680  Methane metabolism
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01120  Microbial metabolism in diverse environments
cpy01130  Biosynthesis of antibiotics
cpy01200  Carbon metabolism
cpy01230  Biosynthesis of amino acids
Module
cpy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_3303
  Energy metabolism
   00680 Methane metabolism
    Cphy_3303
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_3303
Enzymes [BR:cpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cphy_3303
Membrane trafficking [BR:cpy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cphy_3303
Exosome [BR:cpy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cphy_3303
  Exosomal proteins of melanoma cells
   Cphy_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 SUKH_6 SopE_GEF
Motif
Other DBs
NCBI-ProteinID: ABX43657
UniProt: A9KSK5
Position
complement(4023100..4023702)
Genome map
AA seq 200 aa AA seqDB search
MIILLLRHGESEGDLMDVHEGRADFPLTDRGREQAGKAAKWISKNYSVNRIYSSTLLRAE
ETASLVSMETKVPIELREGLMEFNNGKLAGIDREEAKRKYPEIPDLPIHESRYEMESKLE
FRFRAEAILSEIISNNKEQEVVVVISHGGMINQLLLAYEKQPIESEIWHATGDTGIHCLR
YENGKRGILYLNNTKHLEIV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattattctattattacgccatggagagtcagagggtgacttaatggatgtacatgaa
gggcgtgctgattttcctttaacggataggggaagagaacaagcaggtaaggcagctaag
tggattagtaaaaattattcagttaacagaatctattccagtactttgttaagagcagaa
gaaactgctagtttggtatcaatggaaactaaagtaccaattgaattaagagaaggttta
atggagtttaataacgggaaattagcaggaatagatcgtgaagaagcaaaacgtaagtat
cctgagattccagatttgccaatacacgagagtagatatgagatggagtccaaattagag
tttcgttttcgcgcagaagctatactatccgagataatttctaacaataaggaacaagag
gtcgtggttgtcatatcacatggtggcatgatcaatcagctcttgttagcttatgaaaaa
caaccaatagaatctgaaatttggcatgcaactggtgatacgggaatccattgtttgcga
tatgagaatggaaaacgtggaatcttatatttgaataatacaaaacaccttgagatagtg
tag

DBGET integrated database retrieval system