KEGG   Lachnoclostridium phytofermentans: Cphy_3303Help
Entry
Cphy_3303         CDS       T00619                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphy_3303
   01230 Biosynthesis of amino acids
    Cphy_3303
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_3303
  Energy metabolism
   00680 Methane metabolism
    Cphy_3303
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_3303
Enzymes [BR:cpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cphy_3303
Exosome [BR:cpy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cphy_3303
  Exosomal proteins of melanoma cells
   Cphy_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4023100..4023702)
Genome map
AA seq 200 aa AA seqDB search
MIILLLRHGESEGDLMDVHEGRADFPLTDRGREQAGKAAKWISKNYSVNRIYSSTLLRAE
ETASLVSMETKVPIELREGLMEFNNGKLAGIDREEAKRKYPEIPDLPIHESRYEMESKLE
FRFRAEAILSEIISNNKEQEVVVVISHGGMINQLLLAYEKQPIESEIWHATGDTGIHCLR
YENGKRGILYLNNTKHLEIV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattattctattattacgccatggagagtcagagggtgacttaatggatgtacatgaa
gggcgtgctgattttcctttaacggataggggaagagaacaagcaggtaaggcagctaag
tggattagtaaaaattattcagttaacagaatctattccagtactttgttaagagcagaa
gaaactgctagtttggtatcaatggaaactaaagtaccaattgaattaagagaaggttta
atggagtttaataacgggaaattagcaggaatagatcgtgaagaagcaaaacgtaagtat
cctgagattccagatttgccaatacacgagagtagatatgagatggagtccaaattagag
tttcgttttcgcgcagaagctatactatccgagataatttctaacaataaggaacaagag
gtcgtggttgtcatatcacatggtggcatgatcaatcagctcttgttagcttatgaaaaa
caaccaatagaatctgaaatttggcatgcaactggtgatacgggaatccattgtttgcga
tatgagaatggaaaacgtggaatcttatatttgaataatacaaaacaccttgagatagtg
tag

DBGET integrated database retrieval system