KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003326Help
Entry
CpipJ_CPIJ003326  CDS       T01079                                 

Definition
myo inositol monophosphatase
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cqu00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cqu00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cqu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 342 aa AA seqDB search
MNLGGSIRINKCGVVLIAIGLLLFLYYLSTGKSGSSNYALNKNPNEVNLRKLLIGSIQAA
QRGGLEVVEVSKSIDLKVQSKGKTKEGANDPVTDADFRSHCVMADGLHRIFPKLRIISEE
DSAKQSCPDAKLFDLDPTVMHETNVLDEIVDIDEVTVWIDPLDATQEYTESLTEYVTTMV
CVAVKGVPTIGVVHNPFTKTTVWAWVNKAMSEPLSNMKRDEEVKNPVLIVSRSHTGDVQT
IAKEVFGKNVHIIKAGGAGYKVLKVLNNEATAYLHSTAIKKWDICAGNAILNAVGGKMTD
LNNQEISYSDKDPFVNEKGLLATATSSTHEQYIKKILEKNLL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgggtggatcaattcgaataaacaagtgcggtgtagttttaatagcaataggt
ctgttacttttcctatattacctatcgaccggaaagtctggtagttcaaactacgctttg
aacaaaaatccgaacgaagtcaacttgcgaaagctgctaattgggtccatccaagcggct
cagcgcggtggactcgaggtggtcgaagtttccaagagcatcgacttgaaggtgcagagc
aagggaaaaactaaggaaggtgcgaatgatccggtgacggatgcagactttcgctcgcac
tgcgtaatggcagacggtttgcaccggatattccccaaactaaggatcatatccgaggaa
gacagtgccaagcaaagctgtcccgatgcaaaactgttcgatctggacccgaccgttatg
cacgaaactaatgtattggatgaaattgtggacattgacgaggtgaccgtgtggatagat
cctctggatgcaacgcaggagtatacagaatctctgacagaatacgtgacgacgatggta
tgcgtggccgtgaagggagttccaacgatcggagttgttcacaacccgtttacgaagacg
accgtttgggcttgggtcaacaaggcaatgtctgagccactgtccaacatgaaacgggac
gaagaagtaaagaatcccgttttaattgtgtcccgttctcataccggagatgtacagact
attgctaaagaagtttttggtaaaaatgttcacatcattaaggcaggtggagcaggatac
aaagtattgaaggtgctcaacaacgaagccacggcgtatctccactcgacggccataaaa
aagtgggacatttgtgcgggaaatgccatcctcaacgcagtcggtggcaagatgactgac
ttgaacaatcaggagatatcgtacagtgacaaggatccgttcgtcaacgagaaaggtttg
ctggcgacggcaactagcagtacccatgagcagtacatcaagaagattttggagaaaaat
ctgttgtag

DBGET integrated database retrieval system