KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010979Help
Entry
CpipJ_CPIJ010979  CDS       T01079                                 

Definition
phosphatidylcholine-sterol acyltransferase
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cqu00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cqu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 413 aa AA seqDB search
MKLVPVLLLLMVASAAYGTIFGNGVKFVQDLAGKLRRRNYKDFQRKLSPVIFVPGDGGSQ
MDAIINKVDTVHFFCQKSTDTYFNLWLNKELLVPFVIDCWIDNMRLVYNSTTRKTENAPG
VTTRIPGFGSSEPVEWIDPSHASVGAYFVNIGNALVQNGYKRDVSIRGAPYDFRKGPSEN
KEWFIKVKHLVEETYTINDDQPITFIVHSMGAPMTLLFLQMQSQEWKDKHIKRVISLAGA
WGDDLGAFALSGKVMRAEQITNPSLAWLMPNPMIWKPNEVMVRTLSRVYTMDQMEDFFKD
INFNDGWEMRKDSLPYAMNFTAPGVEIYCLYGTGIDTVENLNYEKTYDLSGKPTLVMGDG
DGTVNRRSLEACQYWNGQQKQPVHLQEFPGADHMQILANLAVMDRIVKVLLFE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggtcccggtgcttctgctgctgatggtggcatcagcagcgtatggaactata
tttggcaatggagttaagtttgtgcaggatttggcagggaaattgcgccggagaaattat
aaggacttccagaggaagctatcgccggtgattttcgttccgggagatggaggcagtcaa
atggacgcaatcatcaataaggtggacaccgtccactttttctgccagaaatcaactgat
acgtactttaacctgtggctaaacaaggaactgctagtgccatttgttatcgactgctgg
attgataacatgagactggtgtacaacagtacgacgcgcaaaacggagaatgccccaggc
gtaacgactaggattccgggtttcggatcttcggagcctgtcgagtggatcgatccctca
cacgccagcgtcggagcttactttgtcaacattggaaacgccctcgtacagaacggttac
aagcgggacgtctcaatccgcggtgcaccgtacgattttcgtaaaggacccagcgaaaac
aaggaatggttcattaaggtgaaacacctcgtcgaagaaacgtacacgataaacgacgat
cagccaatcaccttcattgtacacagcatgggagcaccgatgacgctgctcttcctgcag
atgcaaagccaggagtggaaggacaaacacatcaaacgggttatctcgctggccggtgcc
tggggtgacgatttgggtgcgttcgcactgagcggaaaggtcatgcgggcagaacaaata
acgaacccctcgttggcctggctgatgccgaatccgatgatctggaagcctaacgaggtg
atggtgcggacgctgtctcgggtgtacaccatggatcagatggaggactttttcaaggac
attaatttcaacgatggctgggaaatgcgaaaggattcgcttccgtatgcgatgaacttt
actgcaccaggagtggagatttattgtctgtatggaacagggattgatacggttgaaaac
ttgaactacgaaaaaacatacgatctgtccggcaagccgacactggtaatgggtgacggc
gacggtaccgtcaaccgacgatcgctggaagcctgccagtactggaatggtcagcaaaag
cagccggtgcacctgcaggagttccccggagccgatcacatgcaaatcttggccaatctg
gccgtcatggaccgaatcgtgaaggtgttgcttttcgagtag

DBGET integrated database retrieval system