KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019622Help
Entry
CpipJ_CPIJ019622  CDS       T01079                                 

Definition
dopamine beta hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CpipJ_CPIJ019622
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     CpipJ_CPIJ019622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 451 aa AA seqDB search
MPYNSKKKINKNKTHSMGFDSAHLPKVRRVVSRLVCRVSFSGIRAISTLVVCLDISSTQI
HTLNLDHAKLKLTWMMDWYKKEVLFHVQNTFLHGRYKFFALGFSPRGELRRTDLCIFTRG
PVGHQVLDAYTSRDFNRIYVDSEQNCDVMRIDESSVAFRRKFDTCDPQDVAIHGGTMYVV
WMRGKKELDFGRNWTVMPEIRKGDRGVLQAQILRADTITIPEAKSVSKKVDIKLDKVAIP
AVETTYWCKVQRLESWLAAKKHHVVRFEPIITNEHVVHHMEVFQCVTDSKLEIPLYEGSC
ADLPPEAKACNKVMALWAMGAGPFTYPHETGLPIGGKDFNPYIRLEVHFNNPDLKPNIVD
SSGMRIDVVSKLRKHDAAIMELGLEYSDKMAIPPGQVAFPLTGYCIAECTKVALPPTGIT
IFGSQLHTHLRGHESYIYPTRFTELDKYEEC
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccatacaattcgaagaagaagatcaacaaaaacaaaacgcacagtatgggatttgac
agcgcgcatttgccgaaagtgcggcgcgtcgtttcgaggctggtatgccgcgtgtctttt
tcgggaatacgcgcaatatcgacgttggtggtttgtttggacatctcatcgacgcagatc
cacacgctgaacctggaccacgccaagctgaagctgacctggatgatggactggtacaag
aaggaggtgctcttccacgtgcagaacacgttcctgcacggccggtacaagttcttcgcg
ctgggattttccccgcggggcgaactccggcggacggatttgtgcatctttacgcgcggt
ccggtgggtcaccaggtgctggacgcgtacacctcgcgggactttaaccggatttacgtg
gactcggagcagaactgcgacgtgatgaggatcgacgagtcgagtgtggcgtttcggcgg
aagtttgacacgtgcgatccgcaggatgtggcgattcacgggggaacgatgtacgtggtg
tggatgagggggaagaaggagctggattttgggcggaactggacggtcatgccggagatc
cggaagggcgatcgaggggtgctgcaggcgcagattctgcgggcggacacgattacgatt
ccggaggccaagtcggtgtcgaagaaggtggacatcaagctggacaaggtggcgattccg
gcggtggaaacgacctattggtgcaaggtccaacggttggagtcttggctggcggcgaaa
aaacaccacgtggtgagattcgagccgataatcaccaacgagcacgttgttcaccacatg
gaggtgttccagtgcgtgaccgactccaagctggagatccctctctacgagggaagctgc
gcggatcttccgccggaagcgaaggcctgcaacaaggttatggccctctgggccatgggc
gccggtcccttcacgtacccccacgaaaccggactcccaatcggcggaaaagacttcaac
ccgtacatccggctggaagtccacttcaacaacccggaccttaaacccaacatcgtcgac
agttccggaatgcgcatcgacgtggtttcaaaactccgaaaacacgacgccgccatcatg
gaactcggcctcgagtactccgacaagatggccatcccacctgggcaggtggccttcccg
ctgaccggatattgcatcgcagagtgtaccaaagtggcgctccccccaaccggaatcacc
atctttggctcccagcttcatacccatttgagggggcacgagtcgtacatttatccaacg
aggttcacagagttggataaatacgaagagtgctga

DBGET integrated database retrieval system