KEGG   Chlamydia trachomatis A2497: CTO_0262Help
Entry
CTO_0262          CDS       T02094                                 

Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
cra  Chlamydia trachomatis A2497
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTO_0262
DNA repair and recombination proteins [BR:cra03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CTO_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269241..269843
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYISKLISFLKKLPGIGFKSAEKIAFELLEWDPSQIEAMAQALQEFSTSHATCSN
CFCLKISQTSPCNFCSESRDSSSLCIVATPKDVFALEKSKIFKGHYFVLGNLLSPITGKH
LSLEKLAILKQRIEACSPKEMIIALDATLEGDATALFLKQEFSYLPIKISRLALGMPVGL
SFDFVDANTLARAFSGRNCF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatatcctgattacatttcgaaactcatttcatttttaaaaaagcttccagga
attggctttaaatcagcagaaaaaatagcttttgaattattagaatgggatccatctcaa
attgaggctatggctcaagcattacaagagttctctacttcgcatgcaacttgctcaaac
tgtttttgtttaaaaatctctcaaacttccccttgtaacttttgcagtgaatctcgagat
tcttcttccttatgtattgttgcaactcctaaggatgttttcgctcttgagaaatctaag
atcttcaaaggacactatttcgttttaggaaacttactttctcccatcactggaaagcat
ttgtctttggaaaaattagctattcttaagcagcgaattgaagcttgttcccctaaagaa
atgatcatagctcttgacgcaactttggaaggagatgcaactgcattgtttttgaaacaa
gaattttcttaccttccaataaaaatctctagattagctcttgggatgcctgtcggtctc
tcctttgattttgttgatgctaatactttagctcgagctttctcaggaagaaattgcttt
taa

DBGET integrated database retrieval system