KEGG   Carnobacterium sp. 17-4: CAR_c21870Help
Entry
CAR_c21870        CDS       T01452                                 

Gene name
thlA2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAR_c21870 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CAR_c21870 (thlA2)
   00640 Propanoate metabolism
    CAR_c21870 (thlA2)
   00650 Butanoate metabolism
    CAR_c21870 (thlA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CAR_c21870 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    CAR_c21870 (thlA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAR_c21870 (thlA2)
   00310 Lysine degradation
    CAR_c21870 (thlA2)
   00380 Tryptophan metabolism
    CAR_c21870 (thlA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAR_c21870 (thlA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAR_c21870 (thlA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CAR_c21870 (thlA2)
Enzymes [BR:crn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CAR_c21870 (thlA2)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAR_c21870 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2301828..2303006)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVTALRTPVGSFGGAFKDVSAVDLGAAVVKRAIDSIGLDPAIIDEMIFGNVLSAG
LGQNVARQVAIKAGIPKHVPSFAINKVCGSGLKTVALAAQSILSGDNEIVIAGGTESMSQ
APYVLPDARWGKRMGNGQMIDTMLKDGLTDAFTDIHMGITAENIVGKYQFTREQQDELAV
RSQNNAEKAVTSGRFKEEIVPIEVPQRRGEPKVVDTDEHPRFGTTNESMAKLKPAFKKDG
SVTAGNASGLNDGAAVLIVMSREKADELGLKPLATIKSYASAGVDPKIMGCGPIPATQKA
LKKAGLTVEDIDLIEANEAFAAQALSVITDLKFNTDIVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDSKRGLATLCIGGGQGMSLIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagcagtaatcgtaacagcattaagaacaccagttggatcatttggaggagct
tttaaagatgtatcagccgttgatctaggagctgctgttgtaaaaagagcaattgacagt
attggattagatccagcaataattgatgaaatgatatttggaaacgttttaagtgcaggt
ttaggtcaaaatgttgctagacaagtagctataaaagctgggatcccaaaacatgttcca
tcttttgctatcaataaagtatgtggatcgggattaaaaacggttgctttagcagcacaa
tcaattctttcaggagacaatgaaattgttattgctggtggaaccgaaagtatgagtcaa
gcaccatacgtattgcctgatgcacgatggggtaaacgaatgggtaatggtcaaatgatt
gatacaatgttgaaggatggtttaacggatgcctttaccgatattcatatgggcataaca
gctgaaaatattgttggaaaatatcaatttactcgtgagcaacaagacgaattagcggtt
cgcagtcaaaataatgctgagaaggctgtaacctctggccgattcaaagaagaaatcgtt
ccaatcgaagtacctcaacgcagaggagaacctaaagtagtcgatacagatgaacaccca
cgttttggtacaacaaatgaatcaatggcgaaattaaaacccgctttcaaaaaagatggt
tcagtaactgcaggaaatgcctcaggattgaacgatggtgcagcagtcttgatcgttatg
agccgtgaaaaagcagatgaattaggattgaaacctctagctacaatcaagtcatatgca
agtgcaggtgtagatccaaaaatcatgggatgtggtccaattccagctactcaaaaagca
ttgaaaaaagctggtttaacagtagaagatatagatttgatcgaagcaaatgaagctttt
gcagcacaagcattaagtgtcataacagatttaaaattcaacactgatattgttaacgtc
aatggtggtgctattgctttaggacatccagtcggagctagcggtgctcgtatcttagtc
actttacttcacgaaatggaaaaacgcgattcaaaacgtggattagcaacgttatgtatt
ggcggaggacaaggaatgtcactaatcgttgaacgttaa

DBGET integrated database retrieval system