KEGG   Citrobacter rodentium: ROD_44811Help
Entry
ROD_44811         CDS       T01145                                 

Definition
polysaccharide degrading enzyme
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
cro  Citrobacter rodentium
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ROD_44811
Enzymes [BR:cro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     ROD_44811
    3.2.1.17  lysozyme
     ROD_44811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4733292..4735715
Genome map
AA seq 807 aa AA seqDB search
MKLNLATKALFCMGLTCAALPAFALEAWSGQEGGSTYEVIFDGGVYTNAWWVGASDCPGN
AADNEANNPWRYERAATAAEMDKYGNPTTCETSGGTVTYPAYDNTVSYNAGDIVSYNNAT
YKTSTAQSSYGFAPGQENPWEAYAPVAEWSSSTVYNKGDKVQKNGEEYEAMFYTVGNDPS
VPANQNPTGTNGRPWKPLGAVVSYTQEQLNNAPEYNASTLYESGTLIRYNGANYVSQAKV
QKVSPTDTNPWRIFIDWTGTKEKVGTPKSPWPAHVYAPYVDFTLNSQPDLASLAQNQNVT
HFTMAFVVSKDAETCLPTWGTAYNINDYAQYSKIKALREAGGDVMVSIGGANNAPLAASC
KNVQDLKQHYYDIVDNLNLNVLDFDIEGTWVADHESINRRNEAVKAVQDTWKEEGRKIGI
WYTLPILPTGLTAEGLYVLEDAKAKGVDLAGVNVMTMDYGNSICQSDGTEGQNIHGKCAT
SAIENMHSQLKQIFTDKSDAEINAMMGTTPMIGYNDVQGEVFYMSDAKLVMQDATERGLG
MIGIWSMMRDQPGVAKQVSPEHSGLTAQQAPQYAFSEVFAPFTQAGDSGDLTGDVKAVFV
DVFDGKQRINVNFDASKLSGSNSYRVEVDGQYVFSTEGGKSYYGYRYNYGTQSTIRTGDV
SYLLHAGSVVTVKRTGPDEQILATLTVTEDMLKGNNPLVSSTDVTSLSVKKEKGIPMVYV
GFAADKIASGTDSSYVIKVMGDAKNGNYVFSYDNGKCYYSSKSTSNGITTVKSDERAISA
GETIVVERITPSPATIAKIVVTEDMLK
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatttagccactaaggcccttttttgcatggggctgacttgtgctgcgttg
ccggcatttgctcttgaagcatggagcggccaggagggcggcagtacctacgaagttatt
ttcgatggcggcgtttatacgaacgcatggtgggtaggcgcttccgactgcccggggaat
gctgccgacaatgaagcgaataacccgtggcgttatgagcgcgctgcaaccgcggctgaa
atggataaatacggtaatccaacgacctgtgaaaccagcggcggtacggtaacttatccg
gcttatgataataccgtctcttataatgcaggcgatattgtttcctacaataatgcaact
tataagacgtcgacagcgcaaagcagttacggttttgctccaggccaggagaatccctgg
gaagcttatgctccggttgcagagtggtcatcttccaccgtttataataaaggcgataag
gttcagaaaaacggtgaggaatatgaagccatgttttatacagtaggaaacgatccttct
gttccggctaaccagaacccgaccggtacaaatggccgtccgtggaaaccgcttggcgcg
gttgtctcttacactcaggagcagcttaacaatgcgccggaatacaatgcctccacgctg
tacgagagcggtactctgattcgctacaatggtgctaactacgtctcgcaggcaaaagta
cagaaagtttccccgactgacactaacccgtggcgcatcttcatcgactggaccggcacg
aaagaaaaagtcggtacgcctaaatccccgtggcctgcgcatgtctatgctccctatgtc
gactttaccctgaattcccagcccgatctggcgagcctggcgcagaaccagaatgtaacc
cacttcactatggcgtttgtggtcagtaaggatgcggaaacctgtctcccgacctggggt
acggcgtataacatcaacgactatgcacaatacagcaagataaaggccctgcgtgaagct
ggcggcgatgtgatggtttccattggcggtgcgaataacgccccgctggcggcatcctgt
aaaaatgttcaggatttgaaacagcactactacgatatcgttgataatctgaacctgaac
gtactggacttcgacatcgaaggtacctgggttgcggatcatgaatctatcaatcgccgt
aacgaagcggtgaaggccgttcaggacacctggaaagaagaagggcgtaaaataggtatc
tggtataccctgccgattctgccgaccggtctgaccgcagaaggcctctatgtgctcgag
gatgctaaagcgaagggggttgatctggcgggtgttaacgtaatgaccatggactacggt
aacagcatttgccagtccgatggcaccgaaggccagaatatccatggcaaatgcgccacc
tccgcaattgaaaacatgcacagccagctgaagcagatcttcactgataagagcgatgct
gaaatcaatgcgatgatgggtaccacgccgatgatcggctataacgacgttcagggcgaa
gtattctacatgtcggatgcgaagctggtcatgcaggacgcaactgaacgtgggctgggt
atgattggtatctggtcaatgatgcgcgatcagccgggcgtcgccaaacaggtttctcct
gaacatagtggactgactgcacagcaggcgccgcagtatgcttttagcgaagtgtttgcg
ccgtttacgcaagccggtgattctggcgaccttacaggcgacgtaaaagccgtttttgtg
gacgtattcgatggtaagcaacgtattaatgtgaattttgatgccagcaagcttagcggt
tccaatagttatcgcgtagaagttgatggtcaatatgtcttctcaacggagggcggcaag
tcctattacggataccgttataactatggtacacagtcaacaatacgtactggtgatgta
agctaccttcttcatgccggctctgttgttaccgttaagcgtaccggccctgatgaacaa
attctggctaccctgaccgtaacggaagatatgctgaaggggaataatccgctggtaagc
agtacggatgtcacctctctgtccgtgaagaaagagaagggtattcctatggtttatgtc
ggttttgccgctgataaaattgcttcaggaaccgatagttcttacgtcattaaagtaatg
ggtgatgcgaagaatggtaactacgtctttagttatgataacggtaagtgctactactcc
tcaaaatcaaccagcaatggtattacgacagtgaagtctgatgaacgcgcgatttcggct
ggtgaaaccatcgtggtcgaacgtatcaccccgtctccggcaaccattgcaaaaattgtt
gtgacggaagatatgcttaaataa

DBGET integrated database retrieval system