KEGG   Candidatus Carsonella ruddii CE (Ctenarytaina eucalypti): A33U_0129Help
Entry
A33U_0129         CDS       T02194                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cru  Candidatus Carsonella ruddii CE (Ctenarytaina eucalypti)
Pathway
cru00020  Citrate cycle (TCA cycle)
cru00660  C5-Branched dibasic acid metabolism
cru01100  Metabolic pathways
cru01110  Biosynthesis of secondary metabolites
cru01120  Microbial metabolism in diverse environments
cru01130  Biosynthesis of antibiotics
cru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A33U_0129 (sucC)
   00640 Propanoate metabolism
    A33U_0129 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A33U_0129 (sucC)
Enzymes [BR:cru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A33U_0129 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AFP83586
UniProt: J7GW09
Position
complement(96637..97677)
Genome map
AA seq 346 aa AA seqDB search
MNLYEYEGKLFFIKYNLILNSYLTNKKIYIKNYIYKIQSYYGSRKKNNGICLIKNYNDCK
LFFKKWNKLKYKNNKVKLFLIEKNIFIKKEFYFTFFFINEFLFFIFSDKGGIEIESFKKI
NFLKIKINLFFISYTLFDYLLNINIEKKNINLLLKIFFLTYNIVILKKIYFLEINPLIIF
NNKIYFLDCKIIILFKKIKNFSEKISIFFKINYIQLKGNICCIINGAGLALKILDLFSYN
NIKCFNFIDLSGTIKEQDINNLFNYLILYKQIKVLFINIFGGIISCKKIINCILNLMYKN
FFFKIILKIDGNDKFYSLLKIIKLKNIFIEKNINLSLKKSIILNNV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatatgaatatgaaggaaaattattttttataaaatacaatttaattttaaat
tcttatttaacaaataaaaaaatatatataaaaaattatatttataaaattcaatcttat
tatggttcaagaaaaaaaaataatgggatatgtttaattaaaaactataatgattgtaaa
ttgttttttaaaaaatggaataaattgaaatacaaaaataataaagtaaaattattttta
attgaaaaaaatatttttattaaaaaagaattttattttacttttttttttattaatgaa
tttttattttttattttttcagataaaggaggaatagagattgaatcttttaaaaaaatt
aattttttaaaaataaaaattaatttattttttatatcatatacattatttgattattta
ttaaatataaatattgaaaaaaaaaatataaatttattattaaaaattttttttttaaca
tacaatatagtgattttaaaaaaaatatattttttagaaataaatcctttaataatattt
aataataaaatatattttttagattgtaaaattataattttatttaaaaaaattaaaaat
ttttcagaaaaaatttctattttttttaaaataaattatattcaattaaaaggtaatata
tgttgtattattaatggtgcaggtttagctttaaaaattttagatttattttcttataat
aatataaaatgttttaattttatagatttgagcggtacaataaaagaacaagatataaat
aatttatttaattatttaatattatataaacaaataaaagttttatttattaatatattt
ggtggaattatttcttgtaaaaaaataataaattgtattttaaatttaatgtataaaaat
tttttttttaaaattatattaaaaatagatggaaacgataaattttattcattattaaaa
ataattaaattaaaaaatatttttatagaaaaaaatataaatttatctttaaaaaaaagt
attattctaaataatgtttaa

DBGET integrated database retrieval system