KEGG   Chromohalobacter salexigens: Csal_2067Help
Entry
Csal_2067         CDS       T00347                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
csa  Chromohalobacter salexigens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Csal_2067
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Csal_2067
Enzymes [BR:csa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Csal_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2337075..2338097)
Genome map
AA seq 340 aa AA seqDB search
MTQPLGTVMLDIEGTQLGDEERRLLERPEVGGVILFARNTRDAEQVRRLTREIRELRPDM
LLAIDQEGGRVQRLREGVTRLPSMAALAAGYADAPDEVRSRVHEAGWLLGMEMAACGFDV
TFAPVLDVDDQRSPAIGDRSFSADPTVVAALGEAFIEGLHEAGMVAVGKHFPGHGGVTLD
SHHALPEDNRPLSVLREHDLVPFKALSGKLDAMMPAHVVYTAFDTRPAGFSPSWLGMLRE
EMAFKGVVFSDDLSMAGAHVAGTPAARAEAAWSAGCDMVLVCNDRAAALEIVDAAAGRTS
KRLGKLRYGRARPELETLPALARWRRAHARLEALSETPAS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacccctcggcacggtcatgctggacatcgaaggaacgcagctcggcgatgag
gaacgtcgtctgctggaacgccccgaggtgggtggcgtgattctgtttgcacgcaatacg
cgtgatgccgagcaggtacgccgcctgacgcgcgagattcgcgaactgcgccccgacatg
ctgctggcgatcgaccaggaaggtggtcgagtgcaacgcttgcgcgagggagtgacgcgc
ttgccgagcatggccgcgctggccgccggttatgccgacgcgcccgatgaggtgcgttcg
cgggtacacgaggcggggtggctgttgggtatggaaatggccgcctgcggcttcgatgtc
actttcgcgccggtgctcgacgtggacgatcagcgttcgccggcgatcggggaccgcagt
ttttccgccgatccgacagtcgtggcggctctcggcgaggccttcatcgaaggattacac
gaggccggcatggtggccgtgggcaagcactttcccggccacggcggcgtcaccctcgac
tcgcaccatgccttgcccgaggacaatcggccgttgtcggttctgcgcgagcatgacctg
gtgccgttcaaggccctctccggcaagctggatgccatgatgccggcgcatgtcgtctat
accgcgttcgatacacgtcccgcgggcttctcaccctcctggctgggcatgctgcgcgag
gaaatggccttcaagggcgtggtgttttccgatgatctgagcatggcgggggcgcatgtg
gcgggcacccccgcggcgcgtgccgaggctgcttggtcggcggggtgcgacatggtgctg
gtgtgcaacgaccgcgcggcggcgctcgagatcgtggacgccgcggccggccggacctcg
aagcgcctgggcaagctgcgctacggccgcgcccgtccggaactggagacgctgccggcg
ctggcacgctggcgccgtgcccatgcacgcctggaagcgctctcggaaacaccggcgagt
tga

DBGET integrated database retrieval system