KEGG   Caldicellulosiruptor saccharolyticus: Csac_2230Help
Entry
Csac_2230         CDS       T00506                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Csac_2230
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Csac_2230
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Csac_2230
Enzymes [BR:csc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Csac_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2361330..2362091)
Genome map
AA seq 253 aa AA seqDB search
MNLIDKKFEELKIKGKKAFIGYTTFGYPTKGETLDYIKLIYSYVDVLELGFPFSDPIADG
EVIQRASVKALKEDIKLDHLFYSIEKFKKDKPIAIMLYANTVYKRGIEKFFKDCKDFGAD
AVIIPDISYEESAEFKAACRENGVHYIDLISISSIERAKMIAKTSKGFVYCVTRKGVTGF
KGEIDKSIYELLSELKKVTSTPLAVGFGIKSKEDVLKLKEVADGIVIGSAIINKIDEGKE
DLVSFLETIRSVL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttgattgataagaaatttgaggagctaaaaataaaagggaaaaaggcgtttata
ggttatacaacatttggctatccaactaagggggaaactcttgattatataaagcttatc
tattcatatgtagatgttttggaacttggctttccattttctgatcctattgcagatggt
gaggttattcaaagagcgtcggttaaggccttgaaagaagatataaaattagaccatctt
ttttatagcatagaaaagtttaaaaaggacaagcccattgcaataatgctttatgcaaat
acagtttacaaaaggggaattgaaaagtttttcaaagactgcaaagactttggtgcagat
gcagtgattatacctgatatttcgtatgaagaaagcgctgagtttaaggctgcctgtaga
gaaaatggagtgcattatattgaccttatatctataagctcaattgaaagagcaaaaatg
attgcaaaaacttcaaaagggtttgtttactgtgttacaagaaaaggtgttacaggcttt
aaaggcgaaattgacaaaagcatttatgaactattaagtgaactaaaaaaagttacttca
acacctcttgctgtagggtttggaatcaagagcaaagaagacgtactgaagcttaaagaa
gtagcagacggcattgtcatcggaagtgctattataaataagattgatgagggaaaggaa
gatttagtaagtttcttagaaacaattagaagcgttttatag

DBGET integrated database retrieval system