KEGG   Caulobacter segnis: Cseg_0434Help
Entry
Cseg_0434         CDS       T01221                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
cse  Caulobacter segnis
Pathway
cse02020  Two-component system
cse02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cseg_0434
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cseg_0434
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cseg_0434
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Cseg_0434
Two-component system [BR:cse02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cseg_0434
Bacterial motility proteins [BR:cse02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cseg_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ADG08952
UniProt: D5VEC9
Position
443918..445030
Genome map
AA seq 370 aa AA seqDB search
MPVDRKIRVLIVDDSATVRQTLASVLESDPQIEVIGVASDPFVAARRIRDEIPDVITLDV
EMPRMDGITFLRKLMAQHPVPVVMCSSLVEDGTETLMQALEAGAVDIVLKPKVGVAEHLM
ESRIRICDAVKAAASARVSGARRPPVAVGRTLYEPERKLTADAMLPPPPKAALGSKAMAR
TTETIICMGASTGGTEALRAVLETLPPDSPGIVIVQHMPERFTASFAQRLDSICAVSVKE
AEDGDTVLRGRVLIAPGNKHTLLERSGARYYVSVKDGPLVTRHRPSVDVLFRSAARSAGS
NAVGVIMTGMGDDGARGLEEMKQSGAFTIAQDEASSIVFGMPKEAIARGCVDRVVPLQQI
AAEIQKASKR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgccagtcgatcgaaaaatccgggtcctgatcgtcgatgactccgcgaccgtgcggcag
accttggcgtccgtattggaatccgatccgcagatcgaagtgatcggggtcgcttccgac
cccttcgtcgccgcccgccgcatacgagacgagatcccagacgtcatcaccttggacgtc
gagatgccgcggatggatggcatcaccttcctgcgtaagctgatggcgcagcaccccgta
ccggttgtgatgtgctcgtcgctggtggaggacggcaccgagacgctgatgcaggccttg
gaggccggggcggtcgatattgttctgaagccgaaggtcggggtcgccgagcacctgatg
gaatcgcggatccggatctgcgatgcggtcaaggccgcggccagcgcccgggtctcgggc
gcgcggcggccccccgtggcggtcggtcggacgctgtacgagcccgagcgcaagctgacc
gccgacgccatgctgcccccgccgcccaaggcggcgctcggaagcaaggcgatggcccgc
acgacggaaacgatcatctgcatgggcgcctccaccggcggcacggaggcgctacgcgcc
gttctggagaccctgccgccggattcgcccggcatcgtcatcgtccaacatatgcctgag
cgcttcaccgcctccttcgcccagaggctcgacagcatctgcgccgtgtcggtcaaagag
gcggaggacggcgatacggtgctgcgcggacgggtgctgatcgcgcccggcaacaagcac
acgctgctggagcggagcggcgcccgctactacgtctcggtcaaggacggtccgctcgtg
acgcgacaccgcccgtcggtggatgtcctcttccggtcggccgctcggtccgccggctcc
aacgccgtcggcgtgatcatgaccggcatgggcgacgacggcgcccgcggtctcgaggag
atgaagcagtccggcgccttcacgatcgcccaggacgaggcgtcctcgatcgtgttcggc
atgcccaaggaagcgatcgcgcgcggctgcgtcgatcgcgtggttcccctgcagcagatc
gccgctgaaatccagaaagcttcgaagcgctag

DBGET integrated database retrieval system