KEGG   Cronobacter sakazakii CMCC 45402: P262_01817Help
Entry
P262_01817        CDS       T02955                                 

Definition
yfbQ protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    P262_01817
   01230 Biosynthesis of amino acids
    P262_01817
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P262_01817
   00290 Valine, leucine and isoleucine biosynthesis
    P262_01817
Enzymes [BR:csi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     P262_01817
    2.6.1.66  valine---pyruvate transaminase
     P262_01817
Amino acid related enzymes [BR:csi01007]
 Aminotransferase (transaminase)
  Class I
   P262_01817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327826..1329040)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARDMRDVTVEDIYIGNGVSELIVQAMQALLNTGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLDIVEIARQHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPRIDELDLAINKLGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccatcgaaaaatccagtaagctcgacaatgtctgttatgacatccgcggcccg
gtgcttaaagaggccaaacgccttgaagaagaaggtcaaaaagttcttaagctgaatatc
ggcaacccggcgcctttcggctttgacgcgcccgacgaaattcttgtcgatgtcatccgc
aacctgccgaccgcgcagggctattgcgattccaaagggctatattccgcacgcaaagcc
atcatgcagcactaccaggcgcgcgacatgcgcgatgtaacggtagaagatatttatatc
ggcaatggcgtgtcagaactgatagtccaggcaatgcaggcgctactgaacactggcgat
gaaatgctggttcccgcgcccgattatccgctgtggacggcggcggtgtcgctctccggc
ggcaaagcggtgcactacctttgcgatgaatcctcagactggttcccggatctcgatgac
atccgcgccaaaatcacgccgcgcactcgtgggattgtcatcattaacccgaacaacccg
accggcgcggtctattcgaaagaactgctgctggatatcgttgagattgcccgccagcac
aatctcatcattttcgccgacgaaatttacgacaagatcctctacgatgacgcccagcac
cactcgatcgccgcgctggcgccggatctgctcaccgtcacctttaacggcctttctaaa
acctaccgcgtggcgggtttccgtcagggctggatggtactgaacgggccgaaaaaacac
gccaaagggtatatcgaagggctggaaatgctcgcctcgatgcgcctgtgcgccaatgtc
ccggcgcagcatgccattcagacggcgcttggcggctaccagagcatcagcgaatttatc
gtacccggcgggcggctctatgagcagcgcaaccgcgcctgggaactaatcaatgagatt
ccgggcgttagctgcgtcaaaccgcgcggcgcgctctatatgttcccgaaaatcgacgca
aagcgttttaatattcacgacgatcagaaaatggtgcttgatttcctgcttcaggaaaaa
gtgctgctcgttcagggcaccgcattcaactggccgtggccggatcacgtgcgcatcgta
acgctgccgcgcatcgacgaactcgatctcgccattaacaagctgggccgcttcctttcc
ggctaccatcagtaa

DBGET integrated database retrieval system