KEGG   Cronobacter sakazakii CMCC 45402: P262_01817Help
Entry
P262_01817        CDS       T02955                                 

Definition
yfbQ protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:csi01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:csi01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:csi00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:csi00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327826..1329040)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARDMRDVTVEDIYIGNGVSELIVQAMQALLNTGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLDIVEIARQHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPRIDELDLAINKLGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccatcgaaaaatccagtaagctcgacaatgtctgttatgacatccgcggcccg
gtgcttaaagaggccaaacgccttgaagaagaaggtcaaaaagttcttaagctgaatatc
ggcaacccggcgcctttcggctttgacgcgcccgacgaaattcttgtcgatgtcatccgc
aacctgccgaccgcgcagggctattgcgattccaaagggctatattccgcacgcaaagcc
atcatgcagcactaccaggcgcgcgacatgcgcgatgtaacggtagaagatatttatatc
ggcaatggcgtgtcagaactgatagtccaggcaatgcaggcgctactgaacactggcgat
gaaatgctggttcccgcgcccgattatccgctgtggacggcggcggtgtcgctctccggc
ggcaaagcggtgcactacctttgcgatgaatcctcagactggttcccggatctcgatgac
atccgcgccaaaatcacgccgcgcactcgtgggattgtcatcattaacccgaacaacccg
accggcgcggtctattcgaaagaactgctgctggatatcgttgagattgcccgccagcac
aatctcatcattttcgccgacgaaatttacgacaagatcctctacgatgacgcccagcac
cactcgatcgccgcgctggcgccggatctgctcaccgtcacctttaacggcctttctaaa
acctaccgcgtggcgggtttccgtcagggctggatggtactgaacgggccgaaaaaacac
gccaaagggtatatcgaagggctggaaatgctcgcctcgatgcgcctgtgcgccaatgtc
ccggcgcagcatgccattcagacggcgcttggcggctaccagagcatcagcgaatttatc
gtacccggcgggcggctctatgagcagcgcaaccgcgcctgggaactaatcaatgagatt
ccgggcgttagctgcgtcaaaccgcgcggcgcgctctatatgttcccgaaaatcgacgca
aagcgttttaatattcacgacgatcagaaaatggtgcttgatttcctgcttcaggaaaaa
gtgctgctcgttcagggcaccgcattcaactggccgtggccggatcacgtgcgcatcgta
acgctgccgcgcatcgacgaactcgatctcgccattaacaagctgggccgcttcctttcc
ggctaccatcagtaa

DBGET integrated database retrieval system