KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_00511Help
Entry
CSK29544_00511    CDS       T03903                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00052  Galactose metabolism
csj00500  Starch and sucrose metabolism
csj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CSK29544_00511
   00500 Starch and sucrose metabolism
    CSK29544_00511
Enzymes [BR:csj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CSK29544_00511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AKE93475
UniProt: A0A0F6VQM8
Position
522155..523564
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNP
LGCAHQHKCWGHWSSADLTHWQHEPLALMPDEEYDRGGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGEHWYMVLGAQDLE
LQGKVLLLRSDNLWNWENLGEIAGSTLGGLGESGYMWECPDLFMLDGKAILIACPQGVTR
EEKRYLNTYPSVYLCGDLDYDTPEFRHGPLMELDAGFEFYAPQTTLTDDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELTLRDGLLCQQPVRELAALRGEEQRLEGVAATLSPL
AAESLELMLEAQGDVTLDFAATLRLEWTREGLRLARRSLASGEWQYRYWQGDARRLHILC
DRSSVEIFINDGEGVMSSRYFPAANATLGFEGDAHLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacgctgctgcctgccattttacaggctgtgatgaaaggccagccggtc
gcgcttggcgatcgccactatccgcgctggcatctggcgccggtgacgggcctgatgaac
gacccgaacggttttatccattttcaggggcgctaccacctgttttatcagtggaacccg
ctgggctgtgcgcatcagcataaatgctgggggcactggagctcggcggatctgacgcac
tggcaacacgagccgctggcgctgatgccggatgaagagtatgaccgcggcggctgttat
tccggcagcgcggtggatgacaacgggcgactgacgctctgttacaccggcaacgtgaag
tttgacgacggcacccgcaccgcctggcagtgtctggcggtgcagaacgcggatggcggt
ttcgacaagctcggcccggtgatgccgctgcccggcggctataccggccatgtgcgcgac
ccgaaagtctggcgtcacggcgagcactggtacatggtgctgggcgcgcaggatctggaa
ttgcagggcaaagtgctgctgctgcgctccgacaatctgtggaactgggaaaacctgggc
gagatcgccggcagcacgctcggcgggcttggcgagtcgggttacatgtgggagtgcccg
gaccttttcatgctggacggcaaagcgattctgatcgcctgcccgcagggcgtaacgcgc
gaagaaaagcgctatctcaacacctatccgagcgtgtacctgtgcggcgatctcgattac
gacacgccggaatttcgtcacggcccgctgatggagctggacgccggttttgagttttat
gcgccgcaaaccacgctgaccgacgatggccgccggttacttatcggctggatgggcgtg
ccggacggcgaagagatgttgcagccaacggtggcgcagggctggatccaccagatgacc
tgcccgcgcgaactgacgcttcgcgatggcttgctctgccagcagccggtacgcgaactt
gccgcgctgcgcggcgaggaacagcgcctggagggcgtggccgccacgctctcgccgctc
gcggcggaaagcctggagctgatgctggaggcgcagggcgacgtcacgctcgatttcgcc
gccaccctgcgcctggaatggacgcgcgagggtctgcgccttgcgcgccggagcctcgcc
agcggcgaatggcagtatcgttactggcagggcgacgcccgccgcctgcacattttgtgc
gaccgttccagcgttgagatattcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccaacgcgacgcttggttttgaaggcgacgcgcatctccggctgcgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system