KEGG   Cronobacter sakazakii ES15: ES15_0100Help
Entry
ES15_0100         CDS       T02119                                 

Gene name
pfk1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ES15_0100 (pfk1)
   01230 Biosynthesis of amino acids
    ES15_0100 (pfk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_0100 (pfk1)
   00030 Pentose phosphate pathway
    ES15_0100 (pfk1)
   00051 Fructose and mannose metabolism
    ES15_0100 (pfk1)
   00052 Galactose metabolism
    ES15_0100 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    ES15_0100 (pfk1)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ES15_0100 (pfk1)
Protein phosphatases and associated proteins [BR:csk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ES15_0100 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112033..112995
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGVYDGYLGLYEDRMIQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALHTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHICDIDELAKYIETETK
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacgagtggcggtgatgcgccaggcatgaacgccgcc
atccgcggtgttgtccgcgcggcgctgacggaaggtctggaagtgttcggcgtttacgac
ggctatcttggcctgtatgaagaccgcatgatccagctcgaccgctacagcgtttccgac
atgatcaaccgcggcggcaccttcctcggttccgcgcgcttcccggaattccgcgaagaa
catatccgtgccgtggctatcgagaacatgaagaaacgcggtatcgacgcgctggtggtc
atcggcggcgacggctcctacatgggtgctaaacgcctgaccgaaatgggcttcccgtgc
atcggcctgccgggcaccatcgataacgacgtcgcaggcaccgattacaccatcggttac
ttcaccgcgctgcacaccgtggttgaggcgattgaccgtctgcgcgacacctcgtcttcc
caccagcgtatttccattgtggaagtgatgggtcgttactgcggggacctgaccctggcg
gccgccatcgcgggcggttgcgaatttatcgttctgccggaagtggagttcaaccgcgaa
gatctggtggcagaaatcaaagccggcatcgcaaaaggtaaaaaacacgctatcgttgct
atcaccgagcacatctgcgacatcgacgagctggcgaaatacatcgaaaccgaaaccaaa
cgcgaaacccgcgcgacggtgctcggccatatccagcgcggcggctcgccggtgccttat
gaccgcatcctggcatcccgcatgggcgcttacgccatcgaactgctgctgcagggccac
ggcggccgttgcgtcggcatccagaacgaaaaaatggtgcatcacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggagtgcgcgaaaaagctctac
taa

DBGET integrated database retrieval system