KEGG   Cronobacter sakazakii ES15: ES15_0718Help
Entry
ES15_0718         CDS       T02119                                 

Gene name
atoB
Definition
(GenBank) putative acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ES15_0718 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ES15_0718 (atoB)
   00640 Propanoate metabolism
    ES15_0718 (atoB)
   00650 Butanoate metabolism
    ES15_0718 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    ES15_0718 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ES15_0718 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ES15_0718 (atoB)
   00310 Lysine degradation
    ES15_0718 (atoB)
   00380 Tryptophan metabolism
    ES15_0718 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ES15_0718 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ES15_0718 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ES15_0718 (atoB)
Enzymes [BR:csk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ES15_0718 (atoB)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ES15_0718 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
757860..759038
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEALLTRTGLNPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTGEPGDSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQHKARVAIDSGRFRDEIVPVVIEQMQGAPLVVDTDEQPRADTSAEGLARLSPAFDRLGS
VTAGNASSMNDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtcggggccgctcgcacgcccattggctgctttcagggccag
cttgcgcgtcgctcggcggtcgagctcggcgcggtggtcattgaggcactgctgacgcgc
accgggcttaaccctcaggatgtcgatgaagttatcctgggccaggtgctgacggcaggc
gcaggccagaatccggctcggcagactgcgctcaacagcggcctgccgtggtcggtttcg
gcgattaccatcaatgatgtgtgcggctctggcctgaaggcgctgcatctggcgacgcag
gcgatccagtgcggtgaggcggatgtggtgattgctggcggtcaggaaaatatgagtcgc
gcgccgcatgtgctgaccgaagggcgcaccggcgagcccggcgacagccatattatcgac
agcctggtgcatgacgggttgtgggatgcgtttaacgattaccatatgggcgtcaccgcg
gaaaatctggcgcgcgaatataacatcagccgcgaacatcaggatgcgtacgcgcttgca
tcacagcataaagcgcgggtcgctatcgacagcgggcgctttcgtgacgagatcgtgccc
gtcgtgatcgaacagatgcagggcgcgccgctggtggtcgataccgacgagcagccacgc
gccgataccagcgcggaagggctggcgcgcctgtcgcccgcctttgaccggctgggaagc
gttactgcgggcaacgcctcgtcaatgaatgatggcgcggcggcggtgctgatgatgagc
gccagcaaggcgcaggaaatggggctgccggtgctcgcgcgcatacgcgctttcgcaagc
gtgggcgtcgatccggctctgatgggcatcgcgccggtctacgctacgcggcgctgtctg
gagcgcgcgggctggcagctcaatgatgtcgatcttatcgaggccaatgaggcattcgcg
gcacagacgttgtcggtcggtaagctactggagtgggacgagcgcaaggtgaacgttaac
ggcggtgcgattgccctgggacatccgattggcgcgtccggctgccgcattctggtttct
ctggtccatgagatggtgaaacgtcaggctcgcaaagggctcgccacgctttgcattggt
ggcggccagggcgtggcgctggcgattgaacgcgattaa

DBGET integrated database retrieval system