KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c18920Help
Entry
Cspa_c18920       CDS       T02467                                 

Definition
putative xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
Enzymes [BR:csr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cspa_c18920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2090778..2091572
Genome map
AA seq 264 aa AA seqDB search
MLKKKVIFTALAALVMTSSLTMVENTVFAATTLSTTENTFAKEALSTQKISSAFNTQAVP
KTITSNEIGINGGYNYELWKDHGNTSMTLKDGGAFSCQWSNIGNALFRKGKKFNDTQTYK
QLGNISVNYDCNYQPSGNSYMCVYGWTRGPLVEYYIVDSWGSWRPPGGTSKGTITVDGGI
YDIYETTRINQPSIEGNNTTFKQYWSVRRSKRTSGTISVSKHFAAWESKGMPLGKMHETA
FNIEGYQSSGKADVNSMSINIGNK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaaagtaatttttactgctttagcagcattagttatgacaagttcttta
actatggttgagaatactgtttttgcagcaacaactttaagcacaacagaaaatactttt
gctaaagaagctttaagtacgcaaaaaatttcttcagcatttaacacacaggcagtaccg
aaaacgattacctcaaatgaaattggtattaatggcggctacaactatgaactttggaag
gaccacggaaacaccagcatgacgctaaaggatggtggcgcgtttagttgtcagtggagc
aatatcggaaatgcgttattccgtaaaggcaagaaattcaatgacacccagacatacaaa
cagcttggaaatatatcagtaaactatgattgtaattaccagccatctggcaattcctac
atgtgtgtatatggatggacgagaggtcctctcgtggaatattatatagtagatagctgg
ggcagctggagaccgcctggcggaacatcaaaaggcacaattacagtcgatggtggtatc
tatgacatatatgagaccactcgaatcaaccagccttcaattgaaggaaataatacaact
tttaagcagtattggagcgtccgcagatctaaacgcactagcggaacaatatctgtcagc
aaacactttgccgcttgggaaagtaaaggaatgccacttggaaaaatgcatgaaactgca
tttaacatagagggataccaaagcagtgggaaagctgatgtgaatagtatgtcaattaat
atcggaaataaataa

DBGET integrated database retrieval system