KEGG   Cucumis sativus (cucumber): 101205211Help
Entry
101205211         CDS       T02486                                 

Definition
chalcone synthase 2-like
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101205211
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    101205211
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     101205211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 400 aa AA seqDB search
MASVVSEIRKAQRADGPATVLAIGTATPPHSVLQSDYPDYYFRITKSEHMTQLKEKFSRM
CEKSMIRKRHMYLTEEILRENPNMCAYMAPSLDARQDMVVVEVPKLGKDAASKAIKEWGQ
PKSKITHLIFCTTSGVDMPGADYQLLKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAE
NNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGDGAGAVIVGSDPDLSVERPLYEL
VWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFTPLGISDWNSIF
WIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNMSSACVLFIMDQMRKNSMEEGNS
TTGEGLEWGVLFGFGPGLTVETVVLHSVNIKESTINLASY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgtcgtgtctgaaatccgcaaggctcagagagccgacggccccgccacggtt
ttggcgattggcaccgccacaccaccgcatagcgttctacagtcggactatcctgactac
tactttcgcattactaagtctgaacatatgactcagttgaaggagaagttctcccgaatg
tgtgaaaagtcgatgatcagaaagcgacacatgtatctgacggaggagattcttcgggag
aatccgaatatgtgcgcgtacatggcgccttccttagacgcgcgtcaagacatggtggtt
gttgaagtaccaaaactgggaaaagatgcggcttcaaaagctattaaggagtggggccaa
cccaaatccaaaatcacacatctcatcttctgcaccacttccggcgtcgacatgcccggc
gccgattaccaactcctcaagctcctcggcctccgtccctccgtcaaacgctacatgatg
taccagcaaggatgcttcgctggcggaaccgtgctccgcctcgccaaggatttagcggag
aacaatagaggagcccgagtgttggtcgtctgctccgagatcaccgctgtcaccttccgt
gggccctcggagactcatttggactctatggttggtcaggcgttgtttggagatggtgca
ggggcggtgattgttgggtctgatccggatctgtcagtggagcggccgttgtacgagttg
gtttggaccggagcgacgttgttgccggactccgagggagcgatcgacggacatttgagg
gaagtgggactcaccttccatttgcttaaagatgtacctggccttatctctaagaacatt
gagaagagtcttaaagaagcatttacaccacttggaattagcgattggaattccattttc
tggattgctcatcctggcggccctgccattctcgatcaggtggaggcgaaactaggtcta
aaggaggaaaagatgagagcaactcgagaggttctaagcgagtatggtaacatgtcaagc
gcgtgtgtgttgtttataatggatcaaatgaggaagaactctatggaggaagggaattca
acaaccggagaagggctcgaatggggagttttgttcgggttcgggccggggctaacggtg
gagactgtggtgctacatagtgtcaacataaaggaaagcaccatcaaccttgcctcttat
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system