KEGG   Cucumis sativus (cucumber): 101213022Help
Entry
101213022         CDS       T02486                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101213022
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101213022
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101213022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 979 aa AA seqDB search
MVSGNLFHCRKNSWPPEEYISKSTLQLFDFDSASPPEQAWRRKLNGHANLLKEFSVTFVE
AIKMVRLGIRLWSYVREEASQGRKAPIDPFTRESCKPSASQGVPLGGMGSGSISRGFRGE
FRQWQIIPGTCEASPVMANQFSIFVSRDGGGKKYASVLAPGQHEGLGKDGDSGISSWGWN
LDGQHSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYRDSSLPTAVFVYTLVNTG
RERAKVSLLFTWANSIGGNSHLSGNHVNEPFIDEDGVSGVLLHHKTAKGNPPVTFAIAAC
ETQNVSVTVLPSFGLSEGSCITAKDMWDKMVQDGQFDRDNFSSGPSMPSSPGETLCAAVA
ASAWVEPHGKCTVAFSLSWSSPKVKFLKGFSYHRRYTKFYGTSGKAAQTLAHDALTNYKR
WEEEIEKWQRPVLMDERLPEWYKFTLFNELYFLVAGGTVWIDSSFVGKKASYDQDHLARL
KNDDVKAVEAKVSGRGEEVSRTTTTTTLDGFPSIEYDDENSTSSSHASEDELMVPLKRGY
TDRSYQTYKVLEPGNTEEDVGRFLYLEGVEYVMWCTYDVHFYASYALLELFPKIELNIQR
DFAKAVLSEDGRKVRFLAEGKYGIRKVRGAVPHDLGTHDPWNEMNAYNIHDTSRWKDLNT
KFVLQVYRDFAATRDMSFGVDVWPSVRAAIEYMEQFDRDGDGVIENDGFPDQTYDTWTVH
GISAYCGCLWVAALQAAAAMAHELGDQEFAETCKSKFLKARPVLEAELWNGSYFNYDSGS
SSNSKSIQADQLAGQWYTASSGLPPLFDDFKIKSALRKIYDFNVMKVRGGRMGAVNGMHP
NGKIDETCMQSREIWTGVTYGVAATMILAGMEEEAFKTAEGIFLAGWSEEGFGYWFQTPE
AWSTDGHYRSLIYMRPLSIWGMQWALSLPKAILDAPKINVMDRIHVSSSNTKFFNHETGV
RRIATKAKCFGDSVFNCAC
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggttagtggaaatttgtttcactgtagaaagaactcgtggccaccggaagagtacatc
agcaagtcgactttgcagctgtttgattttgatagtgcttcaccacctgaacaagcttgg
agaaggaaattgaatggccatgcgaatcttcttaaagaatttagtgtcacatttgttgag
gcaattaaaatggttcgacttggtattcggttgtggtcatacgtaagagaagaggcatct
caaggaaggaaagcacctattgatccattcaccagagaaagttgcaaaccttcagcttct
caaggggttccacttggaggaatgggaagtggaagtatatccagagggtttagaggcgag
ttcaggcaatggcaaattattcctggtacatgtgaagcttctcctgtcatggcgaatcaa
ttttctatttttgtatctagagatggagggggtaaaaaatatgcttccgtcttggctcct
ggtcaacatgaaggcctggggaaagatggagactcggggatatcatcatggggatggaat
cttgatggtcagcattccacatatcatgctttgttccctagggcatggacagtatatgac
ggtgagccagatccggaacttaaagtttcgtgtaggcaaatatcaccatttatcccacat
aattatcgagatagcagccttcccacagctgtttttgtatacacattggtaaatacggga
cgagaaagggcgaaagtgagccttctttttacctgggcgaattcaataggaggaaactca
catttatctggcaatcatgtgaatgagccgtttatagatgaagatggagtttctggagtg
cttctacatcacaagaccgcgaaggggaatcctccagttacctttgccatagctgcatgt
gagacgcaaaatgttagtgtgacagttttgccatcctttggactatctgaaggaagttgt
atcacggcgaaggacatgtgggataaaatggtgcaggatgggcaatttgatcgtgataac
ttcagttcgggaccaagcatgccttcctcacctggagagacactttgtgctgcggttgca
gcttctgcatgggtagaacctcatggaaaatgcactgttgcattttctctttcatggtca
tctccaaaagtgaagtttttgaagggattttcatatcataggaggtacacaaagttctat
ggtacttctggaaaggctgctcaaactttggcacatgatgcacttacaaattataagaga
tgggaagaggagattgagaaatggcagaggcctgttctcatggatgaacggctccctgaa
tggtataagttcacattgtttaacgagctttactttctggttgctggtggcacagtctgg
attgattcttcctttgtgggtaaaaaagcgtcatatgatcaagatcacctagctagattg
aaaaatgatgatgtaaaggctgtagaagctaaagttagtggcaggggagaagaagtctcc
agaactacgaccaccactactcttgatgggtttcctagcatcgaatatgatgacgaaaat
tctacttctagttcccatgcaagtgaagatgagttgatggttccattaaaaaggggctat
actgaccgttcttatcaaacatacaaagtattggagccaggaaatacggaggaagatgtt
ggcagatttctttacttggaaggagtagaatatgtaatgtggtgcacgtatgatgtgcat
ttctatgcatcctatgcccttcttgagctatttcccaagattgaacttaatattcaacga
gacttcgccaaagcagtcttatcagaggatggaagaaaagtgaggtttcttgctgaagga
aaatatggtatccgtaaggtgaggggtgctgttccacatgaccttgggacacatgatcct
tggaatgaaatgaatgcttacaatatccacgatacgagccggtggaaggatttgaacaca
aagttcgtgcttcaggtttatagagattttgctgcaacaagggacatgtcatttggagtt
gatgtttggccctctgttcgtgctgcgatagagtacatggaacaatttgatagagatggt
gatggtgttattgagaatgatggatttccagaccagacctatgatacttggactgttcat
ggtattagtgcatactgtggctgtttatgggttgcagctttacaagctgcagcagcaatg
gcccatgagctgggtgatcaagaatttgccgaaacttgcaagagcaaatttctaaaagcc
agaccagttttggaagcagaactgtggaatggttcttattttaactatgacagtggatca
agcagtaatagtaaatcaattcaagctgatcaactagcagggcaatggtatacagcatcc
tctggtttgcctcctttgttcgatgacttcaaaatcaaaagtgctctaagaaaaatctac
gacttcaatgtgatgaaagttagaggaggtaggatgggtgctgtaaatgggatgcatccc
aatggaaagattgatgagacctgcatgcagtctcgtgaaatatggactggtgttacctat
ggtgttgccgctacaatgatccttgcaggcatggaggaggaagcatttaaaactgcagag
ggtatcttccttgctgggtggtcagaagagggattcgggtactggtttcagacaccagag
gcatggtccaccgatgggcactacagatcactcatatatatgagaccattgtctatctgg
ggaatgcagtgggcattatccctaccaaaggcgatactcgacgccccaaaaatcaacgta
atggacagaatccatgtttcctcttccaacacaaagttttttaaccatgaaactggtgtc
agaagaatagctacaaaagctaagtgttttggtgattctgttttcaattgtgcatgctaa

DBGET integrated database retrieval system