KEGG   Clostridium thermocellum ATCC 27405: Cthe_0608Help
Entry
Cthe_0608         CDS       T00474                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
745327..746376
Genome map
AA seq 349 aa AA seqDB search
MLIKELTELNGVSGNEDEVRKFIKEEAQKYADSITEDSMGNLICYKKGGSSKYRVMLSAH
MDEVGFMVTGYDDGLIKFASIGGIDERILPGKRVLVGEKRIPGVIGSKPIHLQEKAERGN
NIKLKNMYIDIGAEKKEEAEKLAPLGEYIAFYSMYTEFGDGCIKAKALDDRVGCAILLEI
LKERYGFDLYVCFTVQEEIGLRGAGVAAFRVNPDIAIVVEGTTCSDVPGAREHEYSTVMG
NGAALTIMDRTSYSNKKLVDFMYKTAKDKNIPVQYKQTATGGNDAGKIQLTREGVVVASV
SVPCRYIHSPVSVMNRRDYESCLNLVKAVLEEFDNNESLIESFKLHNVK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgctgataaaagaattgacggagttaaacggggtatccggaaatgaggatgaggtaaga
aaatttataaaagaagaggcgcaaaagtatgcagacagcataaccgaggactcaatggga
aatttgatttgctataaaaaaggcggatcctcaaaataccgcgtaatgttgtccgcccac
atggacgaggtcggatttatggtaacggggtatgatgacggtctgatcaaatttgcaagt
attggtggaatagatgagagaatacttccgggaaagagggttttggtcggggaaaagcgg
attcccggtgttataggttcaaagcccattcatctgcaggaaaaggctgaaaggggaaat
aatatcaagctgaaaaacatgtatatagacataggtgccgaaaaaaaggaagaagccgaa
aaacttgctcctttaggtgaatacatagccttttacagcatgtatactgagtttggtgac
ggctgtataaaggcaaaggctttggatgaccgtgtcggttgtgccatacttcttgaaata
ttgaaagagaggtatggatttgatttgtatgtatgctttaccgttcaggaggagatagga
ttaagaggcgcaggcgttgctgcgttcagggtaaatcctgatattgcaattgttgttgaa
ggaaccacctgctctgatgtgccgggagcccgcgaacatgagtattcaacggtaatggga
aatggagcggcactaactataatggacagaacttcctattccaataaaaagctggttgac
tttatgtacaagacggcgaaagataaaaacataccggtccagtacaagcaaaccgcaacc
ggcggaaatgatgccggaaagatacagttaacccgtgagggagttgtggtggcatcggta
tctgttccctgcaggtatatacattcccctgtgtcggtaatgaaccgaagagactatgaa
agttgcttgaatctcgtaaaagctgtgctggaggagtttgacaacaatgagagcttaatt
gaaagttttaaattgcacaatgtgaagtaa

DBGET integrated database retrieval system