KEGG   Chroococcidiopsis thermalis: Chro_5008Help
Entry
Chro_5008         CDS       T02360                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Chro_5008
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Chro_5008
Enzymes [BR:cthe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Chro_5008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5624714..5627152
Genome map
AA seq 812 aa AA seqDB search
MQFSTLMMNIPNCTWQRPIGLGWDKPYTVRTASNLDDGPWHGMPLGGFGAGCIGRSSRGD
FNVWQVDGGEHIFQPMPACQFSVFESVSERSASRQAYALCTEAPDDGLQNWQWYPSRGEQ
HAHTGTYHALYPRSWFVYEGVFQSQLTCEQFSPIWANNYQESSYPVGVFVWTAHNPTNAP
MTLSIMLSWQNMTGWFTNASKSSEVKIRDDGSPVYEYKSRWGESQGNFNRLVESEYVGCV
LGRDNSEDVEEGDGQWCIATAKQPGVEVFHHTRWNPVGTGEDIWTSFAQSGALPNIQDET
PAIEGEQIAGAIAIRFTLQPGETRTIPFVLTWDFPVTEFAAGVKYYRRHTDFFDRTGKNA
WAIARTALQAYQSWQSQIQAWQQPILDKTDLPNWFKMALFNELYDLTSGGTLWSAATERD
PIGQFAILECIDYRWYESLDVRLYGSFALLILFPELEKAVMRAFARAIPASDNHRRLIGY
YLTIGAEMPLAPRKVAGATPHDLGAPNEHVWEKTNYTAYQDCNLWKDLPSDFVLQVYRDY
LLTGATDVEFLASCWEAIVQALNYLKTFDKDGDGIPENSGAPDQTFDDWKLQGVSAYCGG
LWLAALEAAIAIGKILLNNVERLHVTSLHVTSLQETIDTYQSWLSRSRPIYQEKLWNGQY
YRLDSNSGSDVVMADQLCGQFYARLLKLPDIVPQECALSALKTIYDACFLKFHQGKFGAA
NGLKPNGSPENPNATHPLEVWTGINFGLAAFLLQMGMKAEALQLTETVVNQIYENGLQFR
TPEAITSVGTFRASYYLRAMAIWAIYGVWFEF
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcagcaccttaatgatgaatattcctaactgtacctggcagcgccctatcggt
ctgggctgggataagccctatactgtccgtaccgcaagtaatttagatgatggtccctgg
cacggtatgcctttagggggctttggtgcgggttgtatcggtcggtcttctaggggtgat
tttaacgtgtggcaggtggacggcggcgagcatatttttcagccgatgcctgcttgtcag
tttagcgtgtttgaaagcgtgtctgaacggagtgcatctcgtcaggcttacgctttgtgt
acggaagcacctgacgatggattgcagaattggcagtggtatccatctaggggcgaacaa
cacgcccatacaggcacgtatcatgcgttgtatcctcgtagctggtttgtgtatgagggt
gtgtttcaatctcagttaacctgcgaacagttttcgccaatttgggcaaataactatcaa
gaaagcagctatccagtgggtgtatttgtctggactgcccataatcctactaatgcccct
atgactctgagtattatgctgtcctggcagaatatgacggggtggtttaccaatgccagt
aaatcttcagaagtaaaaattagagatgatggtagcccagtgtatgaatataaatcgcgc
tggggagaaagccagggaaattttaatcggttggtggaatccgagtatgtgggatgcgta
ttagggcgagataatagcgaggatgtagaggaaggagacgggcagtggtgtattgctacg
gcaaaacagccaggtgtagaagtctttcatcacacccgttggaatcctgtcggtacggga
gaagatatatggacaagttttgcccaatcaggtgctttacccaatatacaagatgagaca
ccagctatagagggagaacaaattgcaggtgcgatcgccattcgttttacacttcaacca
ggagaaactcgcacgattccctttgtcttaacttgggattttcccgttacggaatttgct
gctggggtcaaatattatcgtcgccatacagattttttcgatcgcacgggtaaaaatgct
tgggcgatcgcgcgtacagccttacaagcataccagtcttggcaatctcaaattcaagct
tggcagcaaccaattttagataaaaccgatctgcccaattggttcaaaatggcattgttt
aacgaactttacgatcttaccagtggtgggacgctgtggagtgcggcgacagagcgcgat
ccgatcggtcagtttgccattttagaatgtattgattatcgctggtacgaaagccttgac
gtgcggctttacggttcgtttgctctattaatcttatttccagagttagaaaaggctgtg
atgcgtgcttttgcacgggctattcctgctagtgacaatcatcgtcgcctcattggatat
taccttaccatcggggcagaaatgcccctcgcgccgcgtaaagttgctggtgcaacacct
cacgatttaggcgcacccaacgaacacgtttgggaaaagacaaattacacggcatatcaa
gattgcaatttgtggaaggatttacccagcgattttgtcttgcaggtatatcgagactat
ttactgacaggtgcaactgatgtagagtttttagcatcatgttgggaggcgatcgttcaa
gccctcaactatttgaaaactttcgataaagatggcgatggaattcctgaaaattctggt
gcgccagatcaaacttttgatgattggaagttgcagggtgttagtgcttattgtggggga
ttgtggttggcggctttagaagcggcgatcgccattggtaaaattttactcaacaatgta
gagaggttacatgtaacgtctctacatgtaacctctctacaagaaacgatcgacacttat
caatcttggttatcgcgatcgcgtcctatctaccaagaaaaactttggaacggacaatat
tatcgcttggatagcaatagcggttctgatgtcgtaatggcagatcaactctgcggacaa
ttttacgctcgtttattaaaactacctgacattgtaccgcaagaatgtgctttatctgca
ctcaaaactatatacgatgcttgctttttgaaatttcatcagggaaaatttggggcggcg
aatggtttaaaaccgaatggttctcctgaaaatcctaatgctacccatccattagaagta
tggacgggaattaattttggattggcggcttttctcttgcaaatgggaatgaaagctgag
gcactacaattaacagaaacagttgtcaatcaaatttatgaaaatggtttgcaattccgt
actccagaggcaattacatctgttggtacttttcgggcaagctattatttgcgcgcaatg
gcaatttgggcaatttatggcgtgtggtttgagttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system