KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0020Help
Entry
CTLon_0020        CDS       T00646                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28245..29735
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVPSLLAQHILLPFDIAFAQKHLSQEEFSQEAEAFLATASALLRCGYPYFS
ICDETIHPTLPGISNKQLFQWFQLLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIALLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIMVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGRSPVDLLLVDEGSM
VTMNLLHGLIKTIRGESRGETIYADRMVIFGDANQLSPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPRAPIPIIVTERYETWGLTNGDTGVLDPVTEQLRFMNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtaccatctttgttagcacaacatattctt
ctcccttttgatatagcttttgctcaaaagcatttatcccaggaagagtttagtcaggaa
gcagaagctttcttagctacagcatccgcattattgcgttgtggttatccttatttttct
atttgtgatgagacgattcatcccacgctcccagggatttcaaataaacaactcttccaa
tggttccagctgttgtcatcccgcataaaagaagaactgtttgaagttgttaatcataaa
atttatctacgctcattatttcttttacgggagaaggtgtttcataaattgcatagattg
gcgggagccgttccacgtacacctttaatttttgaagagattgctctgctctcagaagag
cagaaccaggtactgaaaactgtattaaattcttgcttctctctcgtttgtggaggacca
ggaacaggcaaaacatttttagctgttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagatcatggtagcttctccaacggggaaagcttccgctcatctgcatagcgta
ttaacgtctcagggaatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagagggcgctcccctgtagatctactattggttgatgaaggctcgatg
gtgaccatgaatctgttacatggactgattaaaaccatacgaggagaatcccgaggggaa
acgatctacgcagatagaatggtgatttttggggatgcgaatcagctttctccaataggt
attggagtgggaaatccttttcatgaagtagtgtctgagttttctaaacaggcatgcttt
ttatctaccagccaccgagctaaacataaggaattacaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttcccgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttggggttttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccacgggcacctattcctatcatcgtgacagaaagatatgaaacgtggggatta
acgaatggagatacaggagttttagatcctgtaacggaacaattgcgtttcatgaatggg
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgtcattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system