KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0076Help
Entry
Cabther_B0076     CDS       T01629                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cabther_B0076
Enzymes [BR:ctm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cabther_B0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:97311..101144
Genome map
AA seq 1277 aa AA seqDB search
MKFLFIALDGQADLALAVAAARVREQHGVNLQVAFHIAAELDRAEAIEKLRADAAEADLV
FVVHQFDDEKIALIRELLHRHAARYQAVICVMCAPSLIRETRLGRFILAKKDEGETPWYS
PLRMIRAVKDSFKKDDDPAAEPKAAQPPGRTMLTMLKNAGKIMKYIPGTAQDIHAYMMSI
QYWLNASADNLEQFLLFLLTRYTEAYRGRFNPKPPVEYPDVGLFHPREGRIVESIRELRA
HVPARPNAPTIGVLMLRSYLLSGNRAHYAAVIEALEQRGANVIPAYAFGLDGRPAVEKYF
LERGRPVVDAVLSLTGFSLVGGPAYNDALAAERLLKQLDVPYICAPSLEFQTIEEWLSDT
QGLNRLQATLMVSIPELDGTTDQIVFAGKSGNSRLLEPIPDRVERLVGRVMARVRLRRLP
PAKRRVAIVLFNFPPSQGNVGTAAYLDVWTSLHRLLGKMQQAGYHLTDVPATVDELRDSI
VHGNAVQYGQPANVCDLFPRLEYERLVPIYREIERSWGPSPGEKNVYGGDFAIMGRVFGN
VGVFVQPSFGFEDDPMRLLFSEDVTPNHGFTAFYAYLNRMWGADVLLHFGTHGATEFMPG
KQVGLSRFCWSDRLIGDLPNIYAYCANNPSEGLIAKRRGYATLVSYLSPPIEAAGLYKEF
VTLKETMDGFRNEPTRREAYVPAIVEKAKELNLLDHDFTPDELTTERFQKLYNDLLELEY
SLIPTGLHTMDDGLDSQELVGMLRVVADFPVAGQRLPSLTKTVLAHWAELNAKSAAGTAG
GDDALAAFSRNVELERQARHFIGEAILEMHQKRSASAGASHLAKLCRAKRSLFDAHFAFL
FDLHEKLRTNAELDAILRALDGRYIAPVAGGDVVRDPGILPTGRNLHAIDPYRMPTYAAT
REAQKSVEQLLERYAREHGGTLPRSVALVLWGTDNLKSGGVGVAQALWLLGARAVADEMG
RIANVELIPLTELSRPRIDVVLTLSGIFRDVLPQQIRLLDRAVRLAAEADEPETQNFIRA
HVQEMLRQGVTWEDAVRRIFSNAAGSYGANVNHLVDSSTWENDSEIAQTFLSRKGFAYDP
NGQFVAARADYERVLGSVTLAFQNVDSTEMNITDIDHYYEYLGGVTSAVKHLRGDGTAPA
VMLADATGAEAKVRSLEETVRLESRTKLLNPKWYEAMLENGYAGVSQIERQVSNTFGWSA
TCQAVDDWVYDGVAQTYVLDEAMRARLQRLNPSSLSKLTRRLLEAHGRGLWKTDEATLEQ
LREAYAQMEDALENVTL
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcttttcatcgcactcgatggacaggccgatctggcccttgctgttgctgcg
gcgcgggtccgtgagcagcacggcgtcaatctccaggtggcctttcacattgcagccgaa
cttgaccgggctgaggccattgaaaagctccgcgccgacgcggcggaagccgacctggtg
tttgtcgtccaccagtttgacgacgaaaaaattgcccttatccgggagttgctccaccgc
catgccgcccgctaccaggctgtcatctgcgtgatgtgcgcgccgtcgctgattcgggaa
acacgcctggggcgcttcatactggccaaaaaggacgaaggcgaaacgccgtggtattca
ccactgcgcatgattcgggccgtcaaggattccttcaaaaaggacgacgacccggccgcc
gaacccaaggcagcccagccgccggggcgcaccatgctcaccatgctcaagaatgccggg
aagattatgaagtacatccccggcacggcgcaggacattcacgcctacatgatgagcatc
cagtactggctcaatgcctcggctgacaatctggagcagtttctgctgtttttgctgacg
cgctacacggaagcctaccgtggccgtttcaacccgaagccgccggttgaataccccgat
gtggggctgtttcacccccgtgaagggcgcattgtcgaatccatcagggaactgcgggcg
cacgtcccggcgcggcccaatgcccccacgattggcgtgctgatgttgcggtcctatctg
ctgtcgggcaaccgggcgcactatgcggccgtcatcgaagcccttgaacagcgtggcgcg
aatgtcattccggcctatgcctttgggttggacggccggccggcggtggaaaaatacttc
ctcgaacgcggccgcccggtggtggatgccgtgctgtcactgaccgggttttctctcgtc
ggcgggccggcctacaacgacgccctggcggccgagcggctgctgaagcagcttgacgtg
ccctacatctgcgcgccctcgctggagtttcagaccatcgaggagtggctctccgacact
cagggactgaaccgccttcaggcaacgctgatggtctccattccagagctggacgggacg
accgatcagattgtctttgccggcaagtccgggaactcgcgcctgctggaacccatcccg
gatcgggtcgagcgtctggttgggcgggttatggcgcgggtccggttgcgccgcctgccg
ccggccaaacggcgcgttgccatcgtgctgttcaactttccgccgagccagggcaacgtt
ggcacggcggcctaccttgatgtgtggacaagcctgcaccgcctgctcggcaaaatgcag
caggctggctaccacctcaccgacgtgccggccacggtggacgaattgcgcgacagcatc
gttcacggcaatgccgtccagtacggccagccggccaacgtctgtgacctgtttccacgg
ctggaatacgagcggctcgtgccgatctaccgcgaaatcgagcggtcgtggggaccctcg
ccaggtgaaaagaacgtctatggcggggacttcgccatcatgggacgggtgtttggcaac
gtcggggtgtttgtccagccgagttttggctttgaagatgacccgatgcgcctgctgttt
tcggaggatgtcacgcccaaccacggttttaccgccttttatgcgtatctcaaccggatg
tggggggcggatgtcctgctccacttcggaacgcacggggcgacggagtttatgcccggc
aagcaggttgggttgagccggttctgctggagcgaccggctcattggcgacctgcctaac
atttatgcctactgcgccaacaacccgtcggaaggtctcattgcgaagcgccggggttac
gcgacgctggtgagttacctcagcccgcccattgaggcagcgggtctgtacaaggaattc
gtgacgctcaaggaaaccatggacggtttccgcaatgaaccgacccggcgcgaggcctac
gttccggccatcgtcgaaaaggccaaggaactcaacctgctcgaccacgacttcactccc
gacgaactgacaaccgaacgcttccagaagctctacaacgacctgctggaactggagtac
agcctcattccaacggggctgcacacgatggatgacggtctcgacagccaggaactcgtc
ggcatgctgcgcgtcgtggcggattttccggttgccgggcagcgcctgccgagcctgacc
aaaaccgtcctggctcactgggccgaactgaacgcgaagtcggccgccggaactgccgga
ggggatgacgcgctggcggccttttcacgaaacgttgaactggagcgacaggcgcggcat
ttcatcggcgaggccatcctggaaatgcaccagaagcgttcggccagcgccggggccagc
cacctggccaaactctgccgcgccaaacggagtctgtttgacgcgcactttgcatttctg
tttgacctgcacgaaaagctccgcaccaacgctgaactcgatgccatcctgcgggctttg
gacgggcgctacattgcgccggtggcgggcggggatgtcgtgcgtgaccccggcattctt
ccgaccgggcgcaacctgcatgccattgacccgtaccgcatgccgacctatgccgcaacg
cgcgaagcccagaagtctgtggagcagcttcttgagcggtatgcgcgcgaacacggcggc
acactgccgcgcagcgtggcgctcgtgctgtggggtaccgacaacctgaaaagtggcggc
gtgggcgtggcccaggccctgtggctgctgggagcgcgggccgtggccgatgaaatgggc
cgcattgccaacgttgaactcatcccgctgaccgagttgagccggccccggattgatgtc
gtgctgacgctgtccggcatcttccgggatgtattgccacagcagatacgtctgcttgac
cgcgctgtgcgcctggcagccgaggcggatgagccggagacacaaaacttcatccgcgcc
cacgtgcaggaaatgctgcggcagggggtgacctgggaagatgccgtccggcggattttc
tcgaatgctgccggcagctacggcgccaacgtcaaccatctggtggattcgtccacgtgg
gaaaacgacagcgaaattgcccagacgttcctctcacgcaagggctttgcctatgacccg
aacgggcagttcgtcgcggcccgggccgactatgaacgggttttgggcagcgtcacgctg
gcgtttcagaacgtggattccaccgaaatgaacatcaccgatattgaccactactacgag
tacctgggcggcgtcaccagcgccgtcaagcacctgcggggcgatggcaccgcgccggct
gtgatgctggccgatgcgacgggagccgaagccaaggtgcgcagtctcgaagaaacggtc
cggctcgaatcccgtaccaagctgctcaatcccaagtggtacgaagccatgctggagaac
ggctacgccggtgtgagccagatcgaacggcaggtctccaacacctttggctggagtgcg
acctgccaggctgtggatgactgggtgtatgacggcgtggcgcagacctacgtgctcgac
gaagccatgcgtgcgcggttgcagcgcctcaaccccagcagtttgtcgaagttgacccgc
cggttgcttgaagcccatgggcgggggctgtggaaaacggacgaggcgacgcttgaacag
ttgcgtgaagcctacgcccagatggaagacgcactggaaaacgtgactttgtaa

DBGET integrated database retrieval system