KEGG   Candida tropicalis: CTRG_02033Help
Entry
CTRG_02033        CDS       T01115                                 

Definition
similar to uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctp  Candida tropicalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTRG_02033
Enzymes [BR:ctp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CTRG_02033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MKNIILLKNPSIPQDPYQIKFSTEYNARFIPLLTHTHKDKSNTISYLMNDEFINNIPIFI
ITSQRAVEMFNECIEEIDIEIREKIYSKSGYTVGPATFNILKNSGFKDVRGGEKAGNGSK
LADLIIKEVDINTPIIFFTGEIRKDIIPKKLINFGYNLKEFIIYKTQNREDIVENFNQVK
LLNQGWIVFFSPQGTKEIVEHLRSCDDSNTNWKIASIGPTTEEYLLEYDIKPHVIATKPE
PESLFQCIYKYDNK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatataatactactaaagaatccaagtatacctcaagatccatatcagatcaaa
ttttcgactgaatataatgctagatttattccattattaacacatacacataaagataaa
tcaaatactatatcatatttaatgaatgatgaatttatcaataatattccaatttttata
ataacttcacaaagagcagttgaaatgtttaatgaatgtattgaagaaatagatattgaa
ataagagagaaaatttattcaaaatctggatatactgttggaccagcaacatttaatatt
ttgaaaaattcaggatttaaagatgttagaggtggtgaaaaagcaggtaatggatctaaa
ttagctgatttaataattaaagaagttgatattaatactcctattatatttttcacaggt
gaaattagaaaagatattattcccaaaaaattaattaattttggttataatttaaaagaa
tttatcatttataaaactcaaaatcgtgaagatatagtggaaaattttaatcaagttaaa
ttacttaatcaaggttggatagtttttttcagtcctcaaggtactaaagaaatagttgaa
catttacgttcatgtgatgatagtaatactaattggaaaattgcttcaataggtccaact
actgaagaatatttattagagtacgatattaaacctcatgtaattgctacaaaaccagaa
ccggaatcattatttcaatgtatatataaatacgacaacaaataa

DBGET integrated database retrieval system