KEGG   Chloroherpeton thalassium: Ctha_0559Help
Entry
Ctha_0559         CDS       T00726                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cts  Chloroherpeton thalassium
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ctha_0559
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Ctha_0559
Enzymes [BR:cts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ctha_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
656931..658850
Genome map
AA seq 639 aa AA seqDB search
MKLSFRNRTKRVGLLAMLFFFTLNAKAQLNEPALNRPAVADSLHIITPLQKEQQAHLSLF
LKKWAWADSILATMTLEEKVGQMLVASSSSYYQSTDDKSYQELSELVKNDLVGGIMFSRG
DVYELAMLANRYQSLAKYPLLISADMEWGVAMRVKRTTEFPNNMGVAATWNPMYAYEMGR
AIAEEARALGIHQNYAPAVDLNNNPENPVINTRAFSENVQLTNAMAKAFVMGSQSARVIA
TAKHFPGHGDTEIDSHRDLPVLPFTRNRLDSLEFRPFKYAITNGVMSVMVGHLALPNLVS
SEQVPATLSPGIISRILRKEFAFDGLIVTDAMTMYGIRKNYSVGEAAVKAVLAGNDILLM
PPDVAVAHEAIVKAVEKADIPLSHIDESVRRILIVKEWLRLHRSRLVDMNAIASKVGTLP
HQMLAQEIADHSITLLRNKGNELPLRVKTTRKRKLLNVMIQNMNSFRVGSTFRRAMKDRF
QVDHFRIFPESNTLNYTDVMKAARKASGIVVSCFVEVRSWSKEFGLDAKQTKLLRDLNSI
ARKRNIPLVVVSFGSPYIIMGHSKVPAYLCAYSSADAAQMSVAKILYGEIEPQGRLPITI
PGEFEFGEGMSFRGELPKEFKFVDYEFSPETANGNATTN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatcttttaggaatagaacgaagcgtgttgggcttctggcgatgctctttttc
tttacactaaatgcgaaagcacagctaaacgaacccgcattgaatcggcctgccgtcgcc
gatagccttcacatcatcacgccactgcagaaagaacagcaagctcatctcagcctattt
ttaaaaaaatgggcttgggctgattcgattttggcgaccatgacgctcgaagaaaaagtc
gggcaaatgcttgtcgcatccagctcatcgtactatcaaagcacggacgacaaatcgtat
caggagctgtcagaattggtgaaaaatgatcttgtcggcggcatcatgttttcgcgaggc
gatgtgtatgaattggccatgttggcgaatcgctaccaatcgctggcaaaatatccgttg
ctgatcagcgccgacatggaatggggcgtggccatgcgcgtgaagcggacaacggagttt
ccgaacaacatgggcgtggccgccacatggaatcccatgtatgcctacgaaatgggacgc
gccattgccgaagaagctcgcgcgcttggcattcatcaaaactacgcgccggctgtcgat
ttgaataacaatcccgaaaaccctgtcatcaatacgcgcgcattcagcgaaaatgttcag
ctaacaaatgccatggccaaagcctttgtgatgggctcgcagtcggcacgagtgattgct
accgcgaagcattttccaggacatggcgacactgaaatcgatagtcatcgcgatttgccc
gttttgccttttacgcgaaatcggcttgattccttggaattccgaccgtttaaatatgcg
atcacaaacggggttatgagtgtcatggtcggacaccttgccctgccaaatttggtatca
tctgagcaagtccccgcaacactttcgccaggcatcatcagtcggattttgcgaaaagaa
tttgcctttgatggcctgattgtcaccgacgccatgaccatgtacggcattcggaaaaat
tattccgttggcgaagcggcagttaaagccgtgctcgcaggaaacgatattttgcttatg
ccacccgatgtggcagttgctcacgaagccattgtgaaagcagtggaaaaagccgacatt
ccgctttctcacatagatgaatctgtgcgccgcattttaatcgtgaaagaatggctgcgg
cttcaccgctcgcgtttggtcgacatgaacgcgatagcaagtaaagtaggaacactgcct
caccaaatgcttgcgcaggaaattgccgatcattccatcacgctgcttcgcaacaaaggc
aatgaattgccgcttcgggtgaaaacaacgcgcaagagaaaattgctgaatgtgatgatt
caaaacatgaacagttttcgtgtaggaagcacgtttcgccgtgctatgaaagatagattc
caagtcgatcattttcggattttccccgaaagcaacacgctcaattacacggatgtgatg
aaagctgcgcgaaaagcatcgggcattgtggtgtcttgttttgtggaagtccgttcatgg
tcaaaggaattcgggctggacgccaagcaaaccaagctgctcagagacctaaatagcatc
gcaagaaaacgaaatattccgctggttgtggtttcgtttggcagcccatacatcatcatg
gggcattcaaaagtgcctgcatacctttgcgcctattccagcgccgatgccgcacaaatg
agcgttgcaaaaattctttatggggaaatcgaaccacaaggtcgcttgcccattacaatt
ccaggtgaattcgaatttggtgaaggcatgagttttcgcggcgaactgccaaaagagttt
aagttcgtcgattacgaattttctcccgaaaccgctaatggcaatgccactacaaattag

DBGET integrated database retrieval system