KEGG   Comamonas testosteroni: CtCNB1_0398Help
Entry
CtCNB1_0398       CDS       T01109                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ctt  Comamonas testosteroni
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ctt00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ctt00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ctt00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ctt00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(438169..439383)
Genome map
AA seq 404 aa AA seqDB search
MSIRFFTPPPLTLSIGLALVGGLNPTTASSAELPPPESWQQCAATTSNNDRLACFDAWAH
KQGPAAAPPATGWSAPAASAQAAPALTAATASANDAAPASAAGATVSSADSGLGLSPNNG
GCRDPRYTEVSRYFELEPGTDCGTFNFRGYRPMSVSVVVGDGVNQQPYSPSRGLATEQPY
QKHEMRLQLSARTKIASGLLTGPTSKGKDSLWFGYTQQSYWQLFNGDISRPFRTTDHEPE
VFYVYPTDAQLPLGWRWRYSGIGIAHQSNGQSNPLSRSWNRWYLMTGAELGNRWQLHLKA
WQRMKESALEDDNPHIQDYIGRGEVKLGWNVNEQNYLGLTARGSLGQGKGSGRIEWLRTL
GEGWNGGKSNLRLHVQLFSGYGDSLVDYNNKRTVLSVGLSLLDF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcgcttcttcaccccgccccccctgaccctgagcatcggcctggcactggtc
ggcggcctgaacccaaccaccgccagcagcgcggaactgccgccccccgaaagctggcag
caatgtgctgccaccaccagcaacaacgaccgcctggcctgctttgatgcctgggcacac
aagcaaggcccggcggctgcgcccccggccaccggttggagtgcacctgcagccagcgca
caagctgcgccggctctcactgccgctaccgcctcggcgaacgatgccgcgcccgccagt
gcggctggggcgactgtttccagcgccgacagcggcctgggtctctcacccaacaacggc
ggctgccgcgatccgcgctacaccgaggtgtcgcgctacttcgagctggagcccggcacg
gactgcggcactttcaacttccgcggctaccgtcccatgtcggtctccgtggtcgtgggc
gacggggtcaatcagcagccctattcgcccagccgcggcctggcgaccgagcagccctac
cagaagcacgagatgcgcctgcagctctcggcccgcaccaagattgcctccggcctgctg
accggccctacctcgaagggcaaggattcgctgtggttcggctatacccagcagtcctac
tggcagctgttcaacggcgatatctcgcggcccttccgcaccaccgaccacgagcccgag
gtcttctacgtctacccgacggacgcccagctgccgctgggctggcgctggcgctactcg
ggcataggcatcgcgcaccagtcgaacggtcagagcaacccgctgtcgcgcagctggaac
cgctggtatctgatgaccggggccgagctgggcaaccgctggcagctgcatctgaaggcc
tggcagcgcatgaaggagagcgcgctcgaggacgacaacccccatatccaggactacatc
ggccgcggtgaagtcaagctgggctggaacgtcaacgagcagaactatctgggcctgact
gcacgcggctcgctgggccagggcaagggctccggtcgtatcgagtggctgcgcaccctg
ggcgaaggctggaacggcggcaagagcaatctgcgcctgcatgttcagctgttcagcggc
tatggcgacagtctggtcgactacaacaacaagcgcacggtactcagcgtgggcctgagc
ctgctggacttctga

DBGET integrated database retrieval system