KEGG   Comamonas testosteroni: CtCNB1_0479Help
Entry
CtCNB1_0479       CDS       T01109                                 

Definition
response regulator receiver modulated CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ctt  Comamonas testosteroni
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ctt02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ctt02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521643..522737
Genome map
AA seq 364 aa AA seqDB search
MIVVDDSALVRSLLAEIINRQHDMECIGSANDPLIAREMIRDLNPDVITLDVEMPRMDGI
DFLGRLMRLRPMPVVMISTLTERGAEVTMRALELGAIDFVAKPRVGVANGLQELASQIVD
KIRVAAVAQVHRLPVVPHGVAAAASAGAKPAAPRAPAAPSLLGRISTEKIIAIGASTGGT
EAIREVLTHLPADCPAIVITQHMPPGFTTSFAARLNSLCQMTVKEATHGERLLPGHAYIA
PGGKHFSITRSGANYVAVVDDAPPVNRHKPSVEVLFKSVAASAGRNAYGIMLTGMGADGA
TAMREMRDAGSYNLVQDESTCIVFGMPREAIVHGAADEVLPLPQIAHALLSKLRGGSDQV
HHRI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtggtggacgactctgcgctggtgcgcagtcttctggccgagatcatcaatcgc
cagcatgacatggagtgcatcggctcggccaatgacccgttgatcgcacgcgaaatgatc
cgcgatctgaaccccgacgtcatcacgctggatgtggaaatgccccgcatggacggcatc
gatttcctcgggcggctcatgcgcctgcgtcccatgccggtggtgatgatctccacgctg
accgaacgcggtgccgaagtcaccatgcgcgccctggagctgggtgccatcgactttgtg
gccaagccccgcgtcggcgtggccaacggcctgcaggagctggccagccagatcgtggac
aagattcgcgtggctgccgtggcccaggtgcaccgcctgccggtggtgccgcacggcgtg
gctgcggcagcgagtgcgggcgccaagcctgctgcgccccgcgcgccagcggcgcccagc
ctgctggggcgcatctcgaccgaaaaaatcatcgccatcggagcctccacgggagggacg
gaagcgattcgtgaggtgctcacgcatctgccggccgactgcccggccatcgtcatcacc
cagcacatgccgccgggcttcaccaccagttttgcggctcggctcaacagcctgtgccag
atgacggtcaaggaggccacgcatggcgagcgcttgctgcccggtcacgcctatatcgca
cctggcggcaagcatttctccatcacgcgcagcggtgccaactatgtggccgtggtcgat
gatgcgccgcccgtcaaccgccacaagccttcggtggaagtgctgttcaagtccgtggcc
gccagcgccgggcgcaatgcctacggcatcatgctcaccggcatgggggccgatggcgcc
accgccatgcgcgagatgcgcgatgccggcagctacaacctggtgcaggacgagagcact
tgcatcgtcttcggcatgccccgcgaagccattgtccatggtgcggccgacgaggtgctg
cctctgccgcagatcgcccatgccctgctgagcaagctgcgcggcggctcggatcaggtg
catcaccgtatctga

DBGET integrated database retrieval system