KEGG   Clostridium thermocellum DSM 1313: Clo1313_1240Help
Entry
Clo1313_1240      CDS       T01933                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Clo1313_1240
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clo1313_1240
Enzymes [BR:ctx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Clo1313_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469877..1471334
Genome map
AA seq 485 aa AA seqDB search
MKLKDLVKGLNVLEVEGDMDVEIKDIAYDSRKAKAGSLFVCIEGFKVDGHKFIPQAIENG
TRAFLVQKDVDVPDDATVVRVKDTRYALASVADIFFGHPSSKFNLVGITGTKGKTTTTYM
IKSILEAFGQKVGLVGTIANMIGHEVLPTDRTTPESYDLQELFSEMVQKNVNSVVMEVSS
HALELHRVSCCEYEIGVFTNLSRDHLDFHKTFENYLNAKIKLFGMCKKGLINIDNEFGPK
VVDSARCEVYTMGIDNKADLRAVDIVHHPDSVDFTVVSPWFTGDVRVNIPGKFSVYNALA
AIGTCALMGVPFEYIKKGLEKVTVPGRAEVLDIKKDYTVMIDYAHSPDSLENILTTVKAY
APGRVVCVFGCGGDRDKTKRPIMGRISGQLADFTIITSDNPRTEDPDAIIRDIEEGIKQT
GGLYTTITDRREAIKYALMNAKPKDIILLAGKGHETYIILKDKTIHFDEREVVRDILKEL
DSGNN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaagacctggtaaaaggacttaatgtacttgaagttgaaggcgatatggat
gtcgaaatcaaggatattgcttatgattccagaaaagcaaaagcaggttctctctttgtc
tgtatagaaggctttaaggtggatggacacaagtttattccccaggcaattgagaatggg
accagagcttttctggttcaaaaagatgttgacgttcccgatgacgcgacggttgtcagg
gttaaggatacaagatatgctcttgccagcgtggccgacatttttttcgggcatccgtca
agcaagtttaatcttgtgggcataaccggtacaaaaggaaagactaccactacatacatg
attaaatcaattcttgaagcctttgggcaaaaggttggacttgtcggtacaatagcaaat
atgataggacacgaagttcttccgacggaccgaacaactccggaaagttacgatcttcaa
gaacttttttcagaaatggtgcaaaaaaacgtaaacagtgttgtgatggaagtgtcttct
catgctctcgagcttcacagggtaagctgctgtgagtatgaaataggggtgtttaccaac
ctttcaagagatcatcttgattttcataaaacttttgaaaattaccttaatgcgaaaatc
aagctttttggcatgtgtaaaaaaggcctaataaatatagacaatgaatttggaccgaaa
gtggtggacagcgccaggtgcgaagtctatacaatggggatagacaacaaagcagatttg
agggcggtggatattgtacatcacccggacagtgtggattttacggttgtttccccttgg
tttaccggggatgtcagagtgaatattcccggaaaattcagtgtatataatgctttagcc
gcaataggaacctgtgctcttatgggagttccctttgaatatatcaaaaaagggttggaa
aaggtaactgtcccaggcagggcggaagttcttgatatcaaaaaagattataccgtaatg
attgactatgcccactcccctgacagtcttgaaaatattttaaccacggtaaaagcatat
gctcccggacgagtagtttgtgtattcggctgtggcggagaccgtgacaaaaccaaaaga
ccgattatgggcaggatatcgggacaattggcggattttacaatcataacttcggataat
ccccggacggaagatccggatgccataataagagacattgaagaaggaattaaacagaca
ggtggtttgtatactacgattaccgataggcgtgaagccataaaatatgctttgatgaat
gcgaagccaaaggacataattctccttgcgggtaagggacatgagacatatataattcta
aaagataaaacaattcattttgacgagagggaagtagtaagggatatattgaaggaattg
gacagtggcaataattaa

DBGET integrated database retrieval system